IKMC Project Report - EUCOMM (ID: 69665)
1700011I03Rik MGI:1922694 ENSMUSG00000058925 OTTMUSG00000033166
Mice no data available
Mutagenesis Predictions
This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000079738 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRETHQTVDRQYFLWNTWRFA*
|
||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000135806 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRETHQTVDRQYFLWNTWRFA*
|
||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000123872 | protein_coding | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000127130 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0510_3_B11 | PG00111_W_4_E02 | 1700011I03Riktm1a(EUCOMM)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0510_3_G11 | PG00111_W_4_E02 | 1700011I03Riktm1a(EUCOMM)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0838_4_C01 | PG00111_W_4_E02 | 1700011I03Riktm1e(EUCOMM)Hmgu | Targeted Non-Conditional (Promotor Driven Cassette) | JM8.N4 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 77611 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00111_W_4_E02 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 77611 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00111_C_E02 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 77611 | Knockout First, Reporter-tagged insertion with conditional potential | PCTS00111_B_E02 |