IKMC Project Report - EUCOMM (ID: 69665)

1700011I03Rik MGI:1922694 ENSMUSG00000058925 OTTMUSG00000033166
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000079738 protein_coding No protein product (NMD) view

Predicted translation: 

MRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRETHQTVDRQYFLWNTWRFA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000482525 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000481565 CDS Deleted
ENSMUSE00000625384 CDS CDS + stop codon + UTR
ENSMUSE00000492044 CDS
ENSMUSE00000491056 CDS
ENSMUSE00000493850 CDS
ENSMUSE00001075967 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000135806 protein_coding No protein product (NMD) view

Predicted translation: 

MRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRETHQTVDRQYFLWNTWRFA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000735703 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000481565 CDS Deleted
ENSMUSE00000625384 CDS CDS + stop codon + UTR
ENSMUSE00000492044 CDS
ENSMUSE00000491056 CDS
ENSMUSE00000974815 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123872 protein_coding Target region does not overlap transcript
ENSMUST00000127130 protein_coding No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0510_3_B11 PG00111_W_4_E02 1700011I03Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0510_3_G11 PG00111_W_4_E02 1700011I03Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0838_4_C01 PG00111_W_4_E02 1700011I03Riktm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 77611 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00111_W_4_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 77611 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00111_C_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
77611 Knockout First, Reporter-tagged insertion with conditional potential PCTS00111_B_E02