IKMC Project Report - EUCOMM (ID: 69892)

Pik3ip1 MGI:1917016 ENSMUSG00000034614 OTTMUSG00000000761
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000045153 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNHNYCRNPDQDPRGP
WCYISSETGVPEKRPCEDVSCPGGRT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000814250 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000314307 Kringle (38/64 aa) CDS CDS
ENSMUSE00000314300 Kringle (27/64 aa) CDS CDS
ENSMUSE00001044399 CDS Deleted
ENSMUSE00000314288 CDS Deleted
ENSMUSE00000314282 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000136536 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNHNYCRNPDQDPRGP
WCYISSETGVPEKRPCEDVSCPGTRPGTTGGRT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000744140 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000314307 Kringle (38/64 aa) CDS CDS
ENSMUSE00000776763 Kringle (27/64 aa) CDS CDS
ENSMUSE00001044399 CDS Deleted
ENSMUSE00000314288 CDS Deleted
ENSMUSE00000803747 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000093399 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNHNYCRNPDQDPRGP
WCYISSETGVPEKRPCEDVSCP

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000595383 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000314307 Kringle (38/64 aa) CDS CDS
ENSMUSE00000314300 Kringle (27/64 aa) CDS CDS + stop codon + UTR
ENSMUSE00001044399 CDS Deleted
ENSMUSE00000682486 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000136474 protein_coding Novel C-terminal product view

Predicted translation: 

MRRKRVRGRCSESPCPCLPSQTPPVRPWMKTPSLCTATRLLLTCRRAAP

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000842349 UTR + start codon + CDS
ENSMUSE00001044399 CDS Deleted
ENSMUSE00000314288 CDS Deleted
ENSMUSE00000811572 CDS + stop codon + UTR UTR + start codon + CDS
Legend: in frame deleted frameshifted
ENSMUST00000138907 protein_coding No analysis available: incomplete transcript
ENSMUST00000153733 retained_intron No analysis available: incomplete transcript
ENSMUST00000139139 processed_transcript No analysis available: incomplete transcript
ENSMUST00000130747 processed_transcript Target region does not overlap transcript
ENSMUST00000142961 retained_intron No analysis available: incomplete transcript
ENSMUST00000149253 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available