IKMC Project Report - EUCOMM (ID: 70299)

Tube1 MGI:1919174 ENSMUSG00000019845
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000019991 protein_coding No protein product (NMD) view

Predicted translation:

MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQSCWGWWQYFQRKNIFSKSTGCFD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000576625 Tubulin_FtsZ_GTPase (4/216 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000332215 Tubulin_FtsZ_GTPase (25/216 aa) CDS CDS
ENSMUSE00000098484 Tubulin_FtsZ_GTPase (18/216 aa) CDS Deleted
ENSMUSE00000098486 Tubulin_FtsZ_GTPase (20/216 aa) CDS CDS
ENSMUSE00000098491 Tubulin_FtsZ_GTPase (39/216 aa) CDS CDS + stop codon + UTR
ENSMUSE00000315651 Tubulin_FtsZ_GTPase (42/216 aa) CDS
ENSMUSE00000355384 Tubulin_FtsZ_GTPase (63/216 aa) CDS
ENSMUSE00000401157 Tubulin_FtsZ_GTPase (9/216 aa) CDS
ENSMUSE00000098497 Tubulin/FtsZ_2-layer-sand-dom (24/120 aa) CDS
ENSMUSE00000315630 Tubulin/FtsZ_2-layer-sand-dom (48/120 aa) CDS
ENSMUSE00000098496 Tubulin/FtsZ_2-layer-sand-dom (50/120 aa) CDS
ENSMUSE00000098499 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 81944 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00091_W_3_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 81944 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00091_W_2_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 81944 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00091_W_4_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
81944 Knockout First, Reporter-tagged insertion with conditional potential PCTS00091_A_A08