IKMC Project Report - KOMP-CSD (ID: 70352)

Adcyap1r1 MGI:108449 ENSMUSG00000029778 OTTMUSG00000035961
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 8 are protein-coding. Following removal of the floxed region, 8 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000070736 protein_coding No protein product (NMD) view

Predicted translation: 

MARTLQLSLTALLLLPMAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEV
FRIFNPDQVWMTETIGDSGFADSNSLEITGGMQSCHGFLSLLRGVQLLLAVH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000521017 UTR UTR
ENSMUSE00000448958 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000448982 GPCR_2_extracellular_dom (1/86 aa) CDS CDS
ENSMUSE00000192711 GPCR_2_extracellular_dom (37/86 aa) CDS CDS
ENSMUSE00000192703 GPCR_2_extracellular_dom (8/86 aa) CDS CDS
ENSMUSE00000192704 GPCR_2_extracellular_dom (15/86 aa) CDS CDS
ENSMUSE00000192708 GPCR_2_extracellular_dom (29/86 aa) CDS Deleted
ENSMUSE00000192702 GPCR_2_secretin-like (28/274 aa) CDS Deleted
ENSMUSE00000192706 GPCR_2_secretin-like (45/274 aa) CDS Deleted
ENSMUSE00000192715 GPCR_2_secretin-like (52/274 aa) CDS CDS + stop codon + UTR
ENSMUSE00000192710 GPCR_2_secretin-like (21/274 aa) CDS
ENSMUSE00000192714 GPCR_2_secretin-like (24/274 aa) CDS
ENSMUSE00000192713 GPCR_2_secretin-like (31/274 aa) CDS
ENSMUSE00000192707 GPCR_2_secretin-like (29/274 aa) CDS
ENSMUSE00000192705 GPCR_2_secretin-like (44/274 aa) CDS
ENSMUSE00000999559 GPCR_2_secretin-like (5/274 aa) CDS
ENSMUSE00000873306 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000070756 protein_coding No protein product (NMD) view

Predicted translation: 

MARTLQLSLTALLLLPMAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEV
FRIFNPDQVWMTETIGDSGFADSNSLEITGGMQSCHGFLSLLRGVQLLLAVH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000911402 UTR UTR
ENSMUSE00000448958 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000448982 GPCR_2_extracellular_dom (1/86 aa) CDS CDS
ENSMUSE00000192711 GPCR_2_extracellular_dom (37/86 aa) CDS CDS
ENSMUSE00000192703 GPCR_2_extracellular_dom (8/86 aa) CDS CDS
ENSMUSE00000192704 GPCR_2_extracellular_dom (15/86 aa) CDS CDS
ENSMUSE00000192708 GPCR_2_extracellular_dom (29/86 aa) CDS Deleted
ENSMUSE00000192702 GPCR_2_secretin-like (28/246 aa) CDS Deleted
ENSMUSE00000192706 GPCR_2_secretin-like (45/246 aa) CDS Deleted
ENSMUSE00000192715 GPCR_2_secretin-like (52/246 aa) CDS CDS + stop codon + UTR
ENSMUSE00000192710 GPCR_2_secretin-like (21/246 aa) CDS
ENSMUSE00000192714 GPCR_2_secretin-like (24/246 aa) CDS
ENSMUSE00000192713 GPCR_2_secretin-like (31/246 aa) CDS
ENSMUSE00000192705 GPCR_2_secretin-like (44/246 aa) CDS
ENSMUSE00000999559 GPCR_2_secretin-like (5/246 aa) CDS
ENSMUSE00000469564 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000167234 protein_coding No analysis available: incomplete transcript
ENSMUST00000165857 protein_coding No analysis available: incomplete transcript
ENSMUST00000165786 protein_coding No analysis available: incomplete transcript
ENSMUST00000172084 protein_coding No analysis available: incomplete transcript
ENSMUST00000166962 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MARTLQLSLTALLLLPMAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEV
FRIFNPDQVWMTETIGDSGFADSNSLEIT

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000900122 UTR UTR
ENSMUSE00000448958 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000448982 GPCR_2_extracellular_dom (1/69 aa) CDS CDS
ENSMUSE00000192711 GPCR_2_extracellular_dom (37/69 aa) CDS CDS
ENSMUSE00000192703 GPCR_2_extracellular_dom (8/69 aa) CDS CDS
ENSMUSE00000192704 GPCR_2_extracellular_dom (15/69 aa) CDS CDS + stop codon + UTR
ENSMUSE00000889837 GPCR_2_extracellular_dom (12/69 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000167484 protein_coding Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00094_B_E01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_B09 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_F11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_A08 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_H06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_C03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_E04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_G08 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_D07 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_G06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_F03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_G11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_F01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_G09 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_B12 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_F06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_B07 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 91952 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00094_Y_5_E09 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
91952 Knockout-First - Reporter Tagged Insertion PCS00094_B_E01