IKMC Project Report - EUCOMM (ID: 70364)

Mrvi1 MGI:1338023 ENSMUSG00000005611 OTTMUSG00000033851
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000125758 protein_coding No protein product (NMD) view

Predicted translation:

MQNQRAHLWLLDPGNGTQFGTGMGRSLTCPFGISPACGAQASWSIFGVGTAEVPGTHSHSNQAAAMPHIPEDEEPPGEPQ
AAQTQDSPSAGPFPSPPTIVLTGDASSPEGETDKNLVNRPLGACH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000781197 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000203351 CDS CDS
ENSMUSE00001089939 CDS Deleted
ENSMUSE00001068499 CDS CDS + stop codon + UTR
ENSMUSE00001061128 CDS
ENSMUSE00000979407 CDS
ENSMUSE00001001527 CDS
ENSMUSE00000203366 MRVI1 (134/592 aa) CDS
ENSMUSE00001056672 MRVI1 (27/592 aa) CDS
ENSMUSE00000203373 MRVI1 (42/592 aa) CDS
ENSMUSE00000203349 MRVI1 (11/592 aa) CDS
ENSMUSE00000203343 MRVI1 (47/592 aa) CDS
ENSMUSE00000203345 MRVI1 (44/592 aa) CDS
ENSMUSE00000203358 MRVI1 (48/592 aa) CDS
ENSMUSE00000203353 MRVI1 (17/592 aa) CDS
ENSMUSE00000203367 MRVI1 (36/592 aa) CDS
ENSMUSE00000305418 MRVI1 (22/592 aa) CDS
ENSMUSE00000203356 MRVI1 (41/592 aa) CDS
ENSMUSE00000203371 MRVI1 (47/592 aa) CDS
ENSMUSE00000305397 MRVI1 (81/592 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000005751 protein_coding No protein product (NMD) view

Predicted translation:

MPHIPEDEEPPGEPQAAQTQDSPSAGPFPSPPTIVLTGDASSPEGETDKNLVNRPLGACH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000527931 UTR UTR
ENSMUSE00001082706 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000203351 CDS CDS
ENSMUSE00001089939 CDS Deleted
ENSMUSE00001068499 CDS CDS + stop codon + UTR
ENSMUSE00001061128 CDS
ENSMUSE00000979407 CDS
ENSMUSE00001001527 CDS
ENSMUSE00000203366 MRVI1 (134/592 aa) CDS
ENSMUSE00001056672 MRVI1 (27/592 aa) CDS
ENSMUSE00000203373 MRVI1 (42/592 aa) CDS
ENSMUSE00000203349 MRVI1 (11/592 aa) CDS
ENSMUSE00000203343 MRVI1 (47/592 aa) CDS
ENSMUSE00000203345 MRVI1 (44/592 aa) CDS
ENSMUSE00000203358 MRVI1 (48/592 aa) CDS
ENSMUSE00000203353 MRVI1 (17/592 aa) CDS
ENSMUSE00000203367 MRVI1 (36/592 aa) CDS
ENSMUSE00000305418 MRVI1 (22/592 aa) CDS
ENSMUSE00000203356 MRVI1 (41/592 aa) CDS
ENSMUSE00000203371 MRVI1 (47/592 aa) CDS
ENSMUSE00000792652 MRVI1 (81/592 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000154466 protein_coding No analysis available: incomplete transcript
ENSMUST00000142368 protein_coding No analysis available: incomplete transcript
ENSMUST00000127935 protein_coding Target region does not overlap transcript
ENSMUST00000149923 processed_transcript Target region does not overlap transcript
ENSMUST00000135590 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 83448 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00091_W_3_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 83448 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00091_W_2_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 83448 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00091_W_1_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 83448 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00091_W_4_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
83448 Knockout First, Reporter-tagged insertion with conditional potential PCTS00091_A_G10