IKMC Project Report - KOMP-CSD (ID: 70638)

Mrpl44 MGI:1916413 ENSMUSG00000026248
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027464 protein_coding No protein product (NMD) view

Predicted translation:

MASAVFRLLQQGPRRLLAPAVPTLAPPVRGVKKGFRAAFRFQKELERWRLLRCPPPPVRRTF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000157294 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000339479 CDS Deleted
ENSMUSE00000157295 CDS CDS + stop codon + UTR
ENSMUSE00000356749 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 114793 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00120_Y_2_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114793 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00120_Y_4_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114793 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00120_B_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114793 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00120_Y_1_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
114793 Knockout-First - Reporter Tagged Insertion PCS00120_C_G08