IKMC Project Report - KOMP-CSD (ID: 70781)

Sp4 MGI:107595 ENSMUSG00000025323
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000026367 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSDQKKEEEEEAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLALLAATCSKIGTPGENQATGQQQIIIDPSQGLVQ
LQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQPASSSSSSSSSNNGSSSPTKTKSGNPSTPNQFQVIQVQNPSGS
VQYQVIPQLQTVEGQQIQINPTSSSSLQDLQGQIQLISAGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGVSIPLQ
LQTLPGTQAQVVTTLPINIGGVTLALPVINNVTAGGGTGQVGQPTTTTDSGTSNGNQLVSTPTTSTAPASTMPESPSSST
TCTTTASTTLTSSDTLVSSADTGQYASTSASSSERTIEEPQTPAATESEAQSSSQLQSNGIQNAQDQSNSLQQVQIVGQP
ILQQIQIQQPQQQIIQAIPPQSFQLQSGQTIQTIQQQPLQNVQLQAVNPTQVLIRAPTLTPSGQISWQTVQVQNIQSLSN
LQVQNAGLSQQLTITPVSSSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSVANLGAAGVQVQGVPVTITSVAGAA
VNQERRSSMFATLKGVGKYMARPLTSEHISDGTLEKDRSYATGCFVAKDSQGAMSFRDTEGPTQVKRDLNVQSVLKGLCG
VITYPSMSKLTRIRKEVGQLLPLLPPENWTHLLQRCLALHGLSRLPPFPKIRIQQLPMFQQTWKNSETLFITKTSSAALK
FTHL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000681206 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000430210 CDS CDS
ENSMUSE00000408850 CDS CDS
ENSMUSE00000367725 CDS Deleted
ENSMUSE00000264377 Znf_C2H2 (25/25 aa) CDS CDS
ENSMUSE00000651705 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0383_6_G05 PRPGS00126_B_C08 Sp4tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0383_6_F06 PRPGS00126_B_C08 Sp4tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0383_6_G08 PRPGS00126_B_C08 Sp4tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0383_6_C07 PRPGS00126_B_C08 Sp4tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 119246 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00126_B_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 119246 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Y_1_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 119246 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Y_5_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 119246 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Y_8_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 119246 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Y_2_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
119246 Knockout First, Reporter-tagged insertion with conditional potential PCS00126_C_C08