IKMC Project Report - NorCOMM (ID: 70991)

Aatk MGI:1197518 ENSMUSG00000025375 OTTMUSG00000004053
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000103020 protein_coding No protein product (NMD) view

Predicted translation:

MLACLCCKKGGIGFKVPGCDHLGAFRVGCAAVPPALGRAGAGLRRPGAAA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661044 UTR UTR
ENSMUSE00000981312 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001088231 CDS Deleted
ENSMUSE00001038563 Ser-Thr/Tyr_kinase_cat_dom (10/266 aa) | Prot_kinase_cat_dom (10/264 aa) CDS Deleted
ENSMUSE00000971852 Ser-Thr/Tyr_kinase_cat_dom (40/266 aa) | Prot_kinase_cat_dom (40/264 aa) CDS Deleted
ENSMUSE00001016504 Ser-Thr/Tyr_kinase_cat_dom (30/266 aa) | Prot_kinase_cat_dom (30/264 aa) CDS Deleted
ENSMUSE00001043208 Ser-Thr/Tyr_kinase_cat_dom (45/266 aa) | Prot_kinase_cat_dom (45/264 aa) CDS Deleted
ENSMUSE00001078337 Ser-Thr/Tyr_kinase_cat_dom (29/266 aa) | Prot_kinase_cat_dom (29/264 aa) CDS Deleted
ENSMUSE00001068430 Ser-Thr/Tyr_kinase_cat_dom (41/266 aa) | Prot_kinase_cat_dom (41/264 aa) CDS Deleted
ENSMUSE00001090915 Ser-Thr/Tyr_kinase_cat_dom (51/266 aa) | Prot_kinase_cat_dom (51/264 aa) CDS CDS + stop codon + UTR
ENSMUSE00000315686 Ser-Thr/Tyr_kinase_cat_dom (24/266 aa) | Prot_kinase_cat_dom (22/264 aa) CDS
ENSMUSE00000971291 CDS
ENSMUSE00000150294 CDS
ENSMUSE00000421410 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000103019 protein_coding No protein product (NMD) view

Predicted translation:

MLACLCCKKGGIGFKVPGCDHLGAFRVGCAAVPPALGRAGAGLRRPGAAA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661042 UTR UTR
ENSMUSE00000981312 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001088231 CDS Deleted
ENSMUSE00001038563 Ser-Thr/Tyr_kinase_cat_dom (10/266 aa) | Prot_kinase_cat_dom (10/264 aa) CDS Deleted
ENSMUSE00000971852 Ser-Thr/Tyr_kinase_cat_dom (40/266 aa) | Prot_kinase_cat_dom (40/264 aa) CDS Deleted
ENSMUSE00001016504 Ser-Thr/Tyr_kinase_cat_dom (30/266 aa) | Prot_kinase_cat_dom (30/264 aa) CDS Deleted
ENSMUSE00001043208 Ser-Thr/Tyr_kinase_cat_dom (45/266 aa) | Prot_kinase_cat_dom (45/264 aa) CDS Deleted
ENSMUSE00001078337 Ser-Thr/Tyr_kinase_cat_dom (29/266 aa) | Prot_kinase_cat_dom (29/264 aa) CDS Deleted
ENSMUSE00001068430 Ser-Thr/Tyr_kinase_cat_dom (41/266 aa) | Prot_kinase_cat_dom (41/264 aa) CDS Deleted
ENSMUSE00001090915 Ser-Thr/Tyr_kinase_cat_dom (51/266 aa) | Prot_kinase_cat_dom (51/264 aa) CDS CDS + stop codon + UTR
ENSMUSE00000315686 Ser-Thr/Tyr_kinase_cat_dom (24/266 aa) | Prot_kinase_cat_dom (22/264 aa) CDS
ENSMUSE00000971291 CDS
ENSMUSE00000150294 CDS
ENSMUSE00000421410 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000064307 protein_coding No protein product (NMD) view

Predicted translation:

MLIALLALAMSSSFFNPSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVVILMLACLCCKKGGIGFKVPGCDHLG
AFRVGCAAVPPALGRAGAGLRRPGAAA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000421441 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001013206 CDS CDS
ENSMUSE00001088231 CDS Deleted
ENSMUSE00001038563 Ser-Thr/Tyr_kinase_cat_dom (10/266 aa) | Prot_kinase_cat_dom (10/264 aa) CDS Deleted
ENSMUSE00000971852 Ser-Thr/Tyr_kinase_cat_dom (40/266 aa) | Prot_kinase_cat_dom (40/264 aa) CDS Deleted
ENSMUSE00001016504 Ser-Thr/Tyr_kinase_cat_dom (30/266 aa) | Prot_kinase_cat_dom (30/264 aa) CDS Deleted
ENSMUSE00001043208 Ser-Thr/Tyr_kinase_cat_dom (45/266 aa) | Prot_kinase_cat_dom (45/264 aa) CDS Deleted
ENSMUSE00001078337 Ser-Thr/Tyr_kinase_cat_dom (29/266 aa) | Prot_kinase_cat_dom (29/264 aa) CDS Deleted
ENSMUSE00001068430 Ser-Thr/Tyr_kinase_cat_dom (41/266 aa) | Prot_kinase_cat_dom (41/264 aa) CDS Deleted
ENSMUSE00001090915 Ser-Thr/Tyr_kinase_cat_dom (51/266 aa) | Prot_kinase_cat_dom (51/264 aa) CDS CDS + stop codon + UTR
ENSMUSE00000315686 Ser-Thr/Tyr_kinase_cat_dom (24/266 aa) | Prot_kinase_cat_dom (22/264 aa) CDS
ENSMUSE00000971291 CDS
ENSMUSE00000150294 CDS
ENSMUSE00000575054 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000150730 processed_transcript No analysis available: incomplete transcript
ENSMUST00000142959 processed_transcript Target region does not overlap transcript
ENSMUST00000132575 processed_transcript No analysis available: incomplete transcript
ENSMUST00000136386 processed_transcript No analysis available: incomplete transcript
ENSMUST00000128836 processed_transcript No analysis available: incomplete transcript
ENSMUST00000134319 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02080P1_C_245W_B5 N02080P1_T_189.5_B08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02080P1_C_245W_B8 N02080P1_T_189.5_B08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02080P1_C_245W_E6 N02080P1_T_189.5_B08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02080P1_C_245W_F6 N02080P1_T_189.5_B08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 243088 Deletion (Promotor Driven Cassette) N02080P1_T_189.5_B08 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
243088 Deletion N02080P1_I_189.5_B08