IKMC Project Report - NorCOMM (ID: 71108)
Map3k8 MGI:1346878 ENSMUSG00000024235 OTTMUSG00000037645
Mice no data available
Mutagenesis Predictions
This gene has 5 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000025078 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MEYMSTGSDEKEEIDLLIKHLNVSEVIDIMENLYASEEPGVYEPSLMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYGT VEDLLAFANHVSNMTKHFYGRRPQECGILLNMLATLYSCLQKLFW*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000173930 | nonsense_mediated_decay | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MEYMSTGSDEKEEIDLLIKHLNVSEVIDIMENLYASEEPGVYEPSLMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYGT VEDLLAFANHVSNMTKHFYGRRPQECGILLNMLATLYSCLQKLFW*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000172805 | retained_intron | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000105472 | processed_transcript | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000173708 | retained_intron | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones (Conditional Ready)
Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | |
|---|---|---|---|---|---|---|---|---|
| order | N02043P1_C_229W_A10 | N02043P1_T_189.2_H03 | Deletion (Promotor Driven Cassette) | C2 | view | no | no data reported ( about ) | |
| order | N02043P1_C_229W_A9 | N02043P1_T_189.2_H03 | Deletion (Promotor Driven Cassette) | C2 | view | no | no data reported ( about ) | |
| order | N02043P1_C_229W_C10 | N02043P1_T_189.2_H03 | Deletion (Promotor Driven Cassette) | C2 | view | no | no data reported ( about ) | |
| order | N02043P1_C_229W_C9 | N02043P1_T_189.2_H03 | Deletion (Promotor Driven Cassette) | C2 | view | no | no data reported ( about ) | |
| order | N02043P1_C_229W_D9 | N02043P1_T_189.2_H03 | Deletion (Promotor Driven Cassette) | C2 | view | no | no data reported ( about ) | |
| order | N02043P1_C_229W_F9 | N02043P1_T_189.2_H03 | Deletion (Promotor Driven Cassette) | C2 | view | no | no data reported ( about ) | |
| order | N02043P1_C_229W_G9 | N02043P1_T_189.2_H03 | Deletion (Promotor Driven Cassette) | C2 | view | no | no data reported ( about ) |
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 242830 | Deletion (Promotor Driven Cassette) | N02043P1_T_189.2_H03 | L1L2_GOHANU | L3L4_pZero_DTA_kan | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 242830 | Deletion | N02043P1_I_189.2_H03 |