IKMC Project Report - NorCOMM (ID: 71287)

F13b MGI:88379 ENSMUSG00000026368 OTTMUSG00000021467
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027615 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MMTLRHLPFILLLILSGELYAEEPCTIDVDHMNRNNIQLKWKYEGKILHGDLIDFVCKQGYNLSPSIPLSEISAQCNRGD
VRYPMCIRKESKGMCASPPVIRNGDIVSSAARTYENGSSVEYRCFDNHFLQGSQNVYCVDGVWTTPPSCLEPCTLSFVEM
DKNYLQLKWNFDNRPLILHGEYIEFMCKRDAYISETSIAGSVLRVQCDRGRLKYPKCTPRDRRLSFQEALRTRRQMEKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001037401 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000972252 Sushi_SCR_CCP (41/41 aa) CDS Deleted
ENSMUSE00000158491 Sushi_SCR_CCP (56/56 aa) CDS Deleted
ENSMUSE00000158485 Sushi_SCR_CCP (56/56 aa) CDS Deleted
ENSMUSE00000158492 Sushi_SCR_CCP (55/55 aa) CDS Deleted
ENSMUSE00000280485 Sushi_SCR_CCP (54/54 aa) CDS Deleted
ENSMUSE00000280480 Sushi_SCR_CCP (54/54 aa) CDS Deleted
ENSMUSE00000158488 Sushi_SCR_CCP (55/55 aa) CDS Deleted
ENSMUSE00000158489 CDS CDS
ENSMUSE00001013067 Sushi_SCR_CCP (55/55 aa) CDS CDS
ENSMUSE00000158490 CDS CDS
ENSMUSE00000394188 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000139080 processed_transcript No analysis available: incomplete transcript
ENSMUST00000141842 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02057P1_C_231W_C8 N02057P1_T_189.3_G03 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 243233 Deletion (Promotor Driven Cassette) N02057P1_T_189.3_G03 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
243233 Deletion N02057P1_I_189.3_G03