IKMC Project Report - NorCOMM (ID: 71341)

Ptpn23 MGI:2144837 ENSMUSG00000036057
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000040021 protein_coding No protein product (NMD) view

Predicted translation:

MEAVPRMPMIWLDLKEAGDFHFQSAVKKVHCTPCWGLWTSGCLRRA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000583195 BRO1_dom (20/375 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000583194 BRO1_dom (25/375 aa) CDS Deleted
ENSMUSE00000583193 BRO1_dom (43/375 aa) CDS Deleted
ENSMUSE00000583192 BRO1_dom (27/375 aa) CDS Deleted
ENSMUSE00000583191 BRO1_dom (17/375 aa) CDS CDS
ENSMUSE00000583190 BRO1_dom (44/375 aa) CDS CDS + stop codon + UTR
ENSMUSE00000583189 BRO1_dom (27/375 aa) CDS
ENSMUSE00000583188 BRO1_dom (44/375 aa) CDS
ENSMUSE00000583187 BRO1_dom (16/375 aa) CDS
ENSMUSE00000583186 BRO1_dom (19/375 aa) CDS
ENSMUSE00000583185 BRO1_dom (20/375 aa) CDS
ENSMUSE00000583184 BRO1_dom (28/375 aa) CDS
ENSMUSE00000583183 BRO1_dom (39/375 aa) CDS
ENSMUSE00000583182 BRO1_dom (11/375 aa) CDS
ENSMUSE00000529295 CDS
ENSMUSE00000529294 CDS
ENSMUSE00000529293 CDS
ENSMUSE00000529292 CDS
ENSMUSE00000529291 CDS
ENSMUSE00000529290 Tyr_Pase_rcpt/non-rcpt (76/231 aa) CDS
ENSMUSE00000309333 Tyr_Pase_rcpt/non-rcpt (62/231 aa) CDS
ENSMUSE00000309312 Tyr_Pase_rcpt/non-rcpt (36/231 aa) CDS
ENSMUSE00000309292 Tyr_Pase_rcpt/non-rcpt (47/231 aa) CDS
ENSMUSE00000309269 Tyr_Pase_rcpt/non-rcpt (12/231 aa) CDS
ENSMUSE00000331626 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02097P1_C_233W_C1 N02097P1_T_189.6_C03 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02097P1_C_233W_C2 N02097P1_T_189.6_C03 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02097P1_C_233W_C4 N02097P1_T_189.6_C03 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02097P1_C_233W_D3 N02097P1_T_189.6_C03 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 241048 Deletion (Promotor Driven Cassette) N02097P1_T_189.6_C03 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
241048 Deletion N02097P1_I_189.6_C03