IKMC Project Report - NorCOMM (ID: 71374)

Abca12 MGI:2676312 ENSMUSG00000050296
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000087268 protein_coding No protein product (NMD) view

Predicted translation: 

MASQFHQLRILVWKNWLGVKRQPVTSHLETFPVLDSSHSYKPCSVTQTLNVKTRPMDHEICSAGRGLMDRYLKKAKF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000629716 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000372320 CDS Deleted
ENSMUSE00000441025 CDS CDS
ENSMUSE00000441018 CDS CDS + stop codon + UTR
ENSMUSE00000441015 CDS
ENSMUSE00000441009 CDS
ENSMUSE00000441001 CDS
ENSMUSE00000600903 CDS
ENSMUSE00000440776 CDS
ENSMUSE00000440769 CDS
ENSMUSE00000440765 CDS
ENSMUSE00000395052 CDS
ENSMUSE00000156772 CDS
ENSMUSE00000156749 CDS
ENSMUSE00000544697 CDS
ENSMUSE00000629737 CDS
ENSMUSE00000156758 CDS
ENSMUSE00000507669 CDS
ENSMUSE00000600902 CDS
ENSMUSE00000600901 CDS
ENSMUSE00000629736 CDS
ENSMUSE00000629735 CDS
ENSMUSE00000629734 CDS
ENSMUSE00000629733 CDS
ENSMUSE00000629732 CDS
ENSMUSE00000629731 CDS
ENSMUSE00000600894 CDS
ENSMUSE00000600893 ABC_transporter-like (3/122 aa) CDS
ENSMUSE00000600892 ABC_transporter-like (74/122 aa) CDS
ENSMUSE00000600861 ABC_transporter-like (47/122 aa) CDS
ENSMUSE00000600890 CDS
ENSMUSE00000600889 CDS
ENSMUSE00000600888 CDS
ENSMUSE00000600887 CDS
ENSMUSE00000600886 CDS
ENSMUSE00000600885 CDS
ENSMUSE00000600884 CDS
ENSMUSE00000600883 CDS
ENSMUSE00000600882 CDS
ENSMUSE00000600881 CDS
ENSMUSE00000600880 CDS
ENSMUSE00000600879 CDS
ENSMUSE00000600878 CDS
ENSMUSE00000600877 CDS
ENSMUSE00000600876 CDS
ENSMUSE00000600875 ABC_transporter-like (24/121 aa) CDS
ENSMUSE00000600874 ABC_transporter-like (48/121 aa) CDS
ENSMUSE00000600873 ABC_transporter-like (45/121 aa) CDS
ENSMUSE00000600872 ABC_transporter-like (5/121 aa) CDS
ENSMUSE00000263267 CDS
ENSMUSE00000156771 CDS
ENSMUSE00000156762 CDS
ENSMUSE00000600871 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02221P1_C_221W_A1 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02221P1_C_221W_B2 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02221P1_C_221W_C2 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02221P1_C_221W_D2 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02221P1_C_221W_E1 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02221P1_C_221W_E2 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02221P1_C_221W_F1 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02221P1_C_221W_G1 N02221P1_T_192.6_D08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 247288 Deletion (Promotor Driven Cassette) N02221P1_T_192.6_D08 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
247288 Deletion N02221P1_I_192.6_D08