IKMC Project Report - NorCOMM (ID: 71377)

Trmt1l MGI:1916185 ENSMUSG00000053286
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000065625 protein_coding No protein product (NMD) view

Predicted translation: 

MENMAEEELLPQEKEEAQVRVPTRAPDSAPVPAPAADTALDSAPTPDSDPAPALAPAPAPALSPSLASVPEEAESKRHIS
IQRRLADLEKLAFGTEGDVDSASSLNSDNPGTENSQTCPLCPKEKFRAYSSHKLRRHLQNLHWKISVEFEGYRMCICHLA
CRPVKPTIVGEQE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000434354 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000434336 CDS CDS
ENSMUSE00000510829 CDS CDS
ENSMUSE00000511987 CDS CDS
ENSMUSE00000501204 CDS Deleted
ENSMUSE00000502174 tRNA_MeTrfase_TRM1 (18/304 aa) | tRNA_Trfase_Trm5/Tyw2 (9/85 aa) CDS Deleted
ENSMUSE00000499138 tRNA_MeTrfase_TRM1 (28/304 aa) | tRNA_Trfase_Trm5/Tyw2 (28/85 aa) CDS Deleted
ENSMUSE00000434423 tRNA_MeTrfase_TRM1 (82/304 aa) | tRNA_Trfase_Trm5/Tyw2 (50/85 aa) CDS CDS + stop codon + UTR
ENSMUSE00000434399 tRNA_MeTrfase_TRM1 (72/304 aa) CDS
ENSMUSE00000434393 tRNA_MeTrfase_TRM1 (65/304 aa) CDS
ENSMUSE00000434388 tRNA_MeTrfase_TRM1 (27/304 aa) CDS
ENSMUSE00000434384 tRNA_MeTrfase_TRM1 (18/304 aa) CDS
ENSMUSE00000434381 CDS
ENSMUSE00000434377 tRNA_MeTrfase_TRM1 (21/59 aa) CDS
ENSMUSE00000537904 tRNA_MeTrfase_TRM1 (39/59 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02213P1_C_218W_A10 N02213P1_T_192.5_H07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02213P1_C_218W_A9 N02213P1_T_192.5_H07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02213P1_C_218W_C11 N02213P1_T_192.5_H07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02213P1_C_218W_F10 N02213P1_T_192.5_H07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 253971 Deletion (Promotor Driven Cassette) N02213P1_T_192.5_H07 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
253971 Deletion N02213P1_I_192.5_H07