IKMC Project Report - NorCOMM (ID: 71385)

Abca14 MGI:2388708 ENSMUSG00000062017 OTTMUSG00000022558
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000084640 protein_coding No protein product (NMD) view

Predicted translation: 

MDSLQMKQFSVLLWKNFLLKSRNVVGLVVEIILIFLLFVWTLTVRRISKKTSISDVIFNPILLTLPKFLNENFDYELAYV
PSESNAARNITEMVKKDLNFNFKGKI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000429415 UTR UTR
ENSMUSE00001001694 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001051599 CDS CDS
ENSMUSE00001012962 CDS Deleted
ENSMUSE00000984635 CDS CDS + stop codon + UTR
ENSMUSE00001022452 CDS
ENSMUSE00001079534 CDS
ENSMUSE00000985028 CDS
ENSMUSE00001091927 CDS
ENSMUSE00000972945 CDS
ENSMUSE00000983272 CDS
ENSMUSE00001025033 ABC_transporter-like (8/121 aa) CDS
ENSMUSE00001015514 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00001076166 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00000980305 ABC_transporter-like (10/121 aa) CDS
ENSMUSE00000527522 CDS
ENSMUSE00000527521 CDS
ENSMUSE00000527520 CDS
ENSMUSE00000527519 CDS
ENSMUSE00000527518 CDS
ENSMUSE00000527517 CDS
ENSMUSE00000527516 CDS
ENSMUSE00000527515 CDS
ENSMUSE00000527514 CDS
ENSMUSE00000527513 CDS
ENSMUSE00001035009 ABC_transporter-like (30/120 aa) CDS
ENSMUSE00000527511 ABC_transporter-like (63/120 aa) CDS
ENSMUSE00001027797 ABC_transporter-like (28/120 aa) CDS
ENSMUSE00000527509 CDS
ENSMUSE00001023264 CDS
ENSMUSE00000527507 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143257 processed_transcript No analysis available: incomplete transcript
ENSMUST00000130646 retained_intron No analysis available: incomplete transcript
ENSMUST00000134268 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02143P1_C_201W_F1 N02143P1_T_192.1_E08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02143P1_C_201W_G1 N02143P1_T_192.1_E08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 254099 Deletion (Promotor Driven Cassette) N02143P1_T_192.1_E08 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
254099 Deletion N02143P1_I_192.1_E08