IKMC Project Report - NorCOMM (ID: 71389)

Noxred1 MGI:1918525 ENSMUSG00000072919
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021423 protein_coding No protein product (NMD) view

Predicted translation: 

MEMLEDLESLRFEFGIPEEERYWLYLQGRYRGLMIKGCAHAAFFCKMFSTLRGSNP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000382662 CDS CDS
ENSMUSE00000114053 NADP_OxRdtase_F420 (39/86 aa) CDS Deleted
ENSMUSE00000114055 NADP_OxRdtase_F420 (48/86 aa) CDS Deleted
ENSMUSE00000114054 CDS Deleted
ENSMUSE00000114052 CDS CDS + stop codon + UTR
ENSMUSE00000114050 CDS
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02227P1_C_222W_B10 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02227P1_C_222W_C10 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02227P1_C_222W_C9 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02227P1_C_222W_D10 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02227P1_C_222W_D9 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02227P1_C_222W_E9 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02227P1_C_222W_F10 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02227P1_C_222W_H9 N02227P1_T_192.6_G10 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 254206 Deletion (Promotor Driven Cassette) N02227P1_T_192.6_G10 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
254206 Deletion N02227P1_I_192.6_G10