IKMC Project Report - (ID: 71395)

non-BioMart die(): Cannot write to '/nfs/team87/services/biomart/ikmc-mart/production/server/releases/20110531105342/logs/log4perl_log': at /software/team87/brave_new_world/lib/perl5/Log/Log4perl/Appender/File.pm line 245.
Pre-pipeline Designs Vectors ES Cells Mice

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033717 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MGASASSPATAVNASNASDGQPASPPSGCPMHKGQRKVSVLVAHRWSDLEVKQESIHQEQEFVPGWGMNCLLTAMTGSSI
VVAQKLDM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000456462 UTR UTR
ENSMUSE00000935665 Cyt_C/C1_haem_lyase (21/249 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000208573 Cyt_C/C1_haem_lyase (51/249 aa) CDS Deleted
ENSMUSE00000208577 Cyt_C/C1_haem_lyase (50/249 aa) CDS Deleted
ENSMUSE00001004144 Cyt_C/C1_haem_lyase (41/249 aa) CDS Deleted
ENSMUSE00001078152 Cyt_C/C1_haem_lyase (30/249 aa) CDS CDS
ENSMUSE00000690511 Cyt_C/C1_haem_lyase (60/249 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112115 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MGASASSPATAVNASNASDGQPASPPSGCPMHKGQRKVSVLVAHRWSDLEVKQESIHQEQEFVPGWGMNCLLTAMTGSSI
VVAQKLDM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000690512 UTR UTR
ENSMUSE00000935665 Cyt_C/C1_haem_lyase (21/249 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000208573 Cyt_C/C1_haem_lyase (51/249 aa) CDS Deleted
ENSMUSE00000208577 Cyt_C/C1_haem_lyase (50/249 aa) CDS Deleted
ENSMUSE00001004144 Cyt_C/C1_haem_lyase (41/249 aa) CDS Deleted
ENSMUSE00001078152 Cyt_C/C1_haem_lyase (30/249 aa) CDS CDS
ENSMUSE00000690511 Cyt_C/C1_haem_lyase (60/249 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000154638 nonsense_mediated_decay Residual N-terminal, novel C-terminal product view

Predicted translation:

MGASASSPATAVNASNASDGQPASPPSGCPMHKGQRKVSVLVAHRWSDLEVKQESIHQEQEFVPGWVFSEQWLTSSYLIQ
QQGRERENMFLKVENNCLRGYQKIIRQTKTFKVRRDQKCLQEYMTQISQDVFHGSQTVCTSDLELTIVPKVSSNSKESS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000769026 UTR UTR
ENSMUSE00000935665 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000208573 CDS Deleted
ENSMUSE00001000601 CDS + stop codon + UTR Deleted
ENSMUSE00000965104 UTR CDS
ENSMUSE00000822648 UTR CDS
ENSMUSE00000755011 UTR CDS
ENSMUSE00000844436 UTR CDS + stop codon + UTR
ENSMUSE00000836958 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available