IKMC Project Report - KOMP-CSD (ID: 71483)

Slc2a3 MGI:95757 ENSMUSG00000003153 OTTMUSG00000036005
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000032476 protein_coding No protein product (NMD) view

Predicted translation:

MGTTKVTPSLVFAVTVATIGSFQFGYNTGVINAPETILKDFLNYTLEERLEDLPSEGLLTALWSLCVAIFSVGGMIGSFS
VGLFVNRFGRRNSMLLVNLLAIIAGCLMGFAKIAESVEMLILGRLLIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQL
GIVVGILVAQIFGLDFILGSEELWPGLLGLTIIPAILQSAALPFCPESPRFLLINKKEEDQATESVLLLNRNLQGRGCPG
TDLCHDWSRRGQYYLHCSFSVPGGEGREENPAYDRPGRHGCLLRFHDDFAVTKG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000911438 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001051842 Sub_transporter (22/452 aa) CDS CDS
ENSMUSE00001093887 Sub_transporter (54/452 aa) | MFS (26/302 aa) CDS CDS
ENSMUSE00001025094 Sub_transporter (81/452 aa) | MFS (81/302 aa) CDS CDS
ENSMUSE00001025049 Sub_transporter (55/452 aa) | MFS (55/302 aa) CDS CDS
ENSMUSE00001033759 Sub_transporter (63/452 aa) | MFS (63/302 aa) CDS Deleted
ENSMUSE00001014604 Sub_transporter (35/452 aa) | MFS (35/302 aa) CDS CDS
ENSMUSE00001011903 Sub_transporter (34/452 aa) | MFS (34/302 aa) CDS CDS
ENSMUSE00001066802 Sub_transporter (68/452 aa) | MFS (10/302 aa) CDS CDS + stop codon + UTR
ENSMUSE00000881431 Sub_transporter (42/452 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000165884 protein_coding Target region does not overlap transcript
ENSMUST00000170724 protein_coding Target region does not overlap transcript
ENSMUST00000168801 protein_coding Target region does not overlap transcript
ENSMUST00000166135 nonsense_mediated_decay No protein product (NMD) view

Predicted translation:

MGTTKVTPSLVFAVTVATIGSFQFGYNTGVINAPETTQLYASSQLAGHHCGLPYGIRQDSGVC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001088844 CDS CDS
ENSMUSE00001051842 Sub_transporter (22/40 aa) CDS CDS
ENSMUSE00001050074 Sub_transporter (18/40 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001075671 UTR UTR
ENSMUSE00001030582 UTR Deleted
ENSMUSE00001048856 UTR UTR
ENSMUSE00001039462 UTR UTR
ENSMUSE00000964941 UTR UTR
ENSMUSE00000895572 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000171541 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000168704 retained_intron No analysis available: incomplete transcript
ENSMUST00000169979 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_8_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00128_B_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_6_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_4_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_2_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_7_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_1_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_5_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 189959 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00128_X_3_D07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
189959 Knockout-First - Reporter Tagged Insertion PCS00128_C_D07