IKMC Project Report - EUCOMM (ID: 71508)

Kctd10 MGI:2141207 ENSMUSG00000001098 OTTMUSG00000014437
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000001125 protein_coding No protein product (NMD) view

Predicted translation: 

MEEMSGDSVVSSAVPAAATRTTSFKGASPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTDSEAEQRYLRA
LLQGTRHHILQGRTEAYSDVK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000690966 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000990496 T1-type_BTB (39/91 aa) CDS CDS
ENSMUSE00001075320 T1-type_BTB (53/91 aa) CDS Deleted
ENSMUSE00000690965 CDS CDS + stop codon + UTR
ENSMUSE00001030994 CDS
ENSMUSE00000989373 CDS
ENSMUSE00000650837 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000102581 protein_coding No protein product (NMD) view

Predicted translation: 

MEEMSGDSVVSSAVPAAATRTTSFKGASPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTDSEEQRYLRAL
LQGTRHHILQGRTEAYSDVK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000845735 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000990496 T1-type_BTB (39/91 aa) CDS CDS
ENSMUSE00001075320 T1-type_BTB (53/91 aa) CDS Deleted
ENSMUSE00001084805 CDS CDS + stop codon + UTR
ENSMUSE00001030994 CDS
ENSMUSE00000989373 CDS
ENSMUSE00000661999 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000134532 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000132646 retained_intron Target region does not overlap transcript
ENSMUST00000135170 retained_intron No analysis available: incomplete transcript
ENSMUST00000123538 retained_intron Target region does not overlap transcript
ENSMUST00000134173 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0784_4_H06 PG00232_Z_6_E03 Kctd10tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0784_4_C06 PG00232_Z_6_E03 Kctd10tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0784_4_E05 PG00232_Z_6_E03 Kctd10tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0784_4_F06 PG00232_Z_6_E03 Kctd10tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0784_4_H07 PG00232_Z_6_E03 Kctd10tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0784_4_D08 PG00232_Z_6_E03 Kctd10tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0784_4_B08 PG00232_Z_6_E03 Kctd10tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 300271 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00232_Z_6_C12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 300271 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00232_Z_6_B03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 300271 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00232_Z_6_A10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 300271 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00232_Z_6_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 300271 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00232_Z_6_C09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 300271 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00232_Z_6_B04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 300271 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00232_Z_6_E03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
300271 Knockout-First - Reporter Tagged Insertion PCS00232_A_F04