IKMC Project Report - EUCOMM (ID: 71760)

R3hdm1 MGI:2448514 ENSMUSG00000056211
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000036288 protein_coding No protein product (NMD) view

Predicted translation: 

MRMSDIVIIKDETETMKDLEAEMRDTTRVENLIKSENYGKISAEKNEHCIDNNIDLQRPPQSFGQTGKRSKSSSKLKLVR
SLAVCEESPPPPAAEISQETQIPAKNTLIQLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000420261 UTR UTR
ENSMUSE00000420236 UTR UTR
ENSMUSE00000319001 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000361623 CDS CDS
ENSMUSE00000395235 CDS CDS
ENSMUSE00000318989 CDS Deleted
ENSMUSE00000518389 CDS CDS + stop codon + UTR
ENSMUSE00000319094 R3H_ss-bd (11/53 aa) CDS
ENSMUSE00000158270 R3H_ss-bd (43/53 aa) CDS
ENSMUSE00000540062 CDS
ENSMUSE00001091708 CDS
ENSMUSE00000997126 CDS
ENSMUSE00000988998 CDS
ENSMUSE00001090962 CDS
ENSMUSE00001051572 CDS
ENSMUSE00000540054 CDS
ENSMUSE00000540052 CDS
ENSMUSE00000540051 CDS
ENSMUSE00000540050 CDS
ENSMUSE00000540049 CDS
ENSMUSE00000333357 CDS
ENSMUSE00000158260 CDS
ENSMUSE00000158281 CDS
ENSMUSE00000318979 CDS
ENSMUSE00000318967 CDS
ENSMUSE00000318957 CDS
ENSMUSE00000381761 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0789_1_F12 PG00236_Z_2_G06 R3hdm1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0789_1_D09 PG00236_Z_2_G06 R3hdm1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0789_1_E11 PG00236_Z_2_G06 R3hdm1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0789_1_G11 PG00236_Z_2_G06 R3hdm1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_M_7_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_Z_2_G06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00236_A_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_Z_2_H11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_Z_8_A09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_Z_2_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_M_5_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_M_2_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_M_8_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296429 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00236_Z_2_B11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
296429 Knockout First, Reporter-tagged insertion with conditional potential PCS00236_A_B02