IKMC Project Report - EUCOMM (ID: 71920)

Myo1a MGI:107732 ENSMUSG00000025401
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000079590 protein_coding No protein product (NMD) view

Predicted translation: 

MPLLEGPVGVEDLILLEPLDEESLIKNLQLRYENKEIYTYIGNVVISMNPYEQLPIYGPEFIAKYRDYTFYELKPHIYAL
ANVAYQSLKDRDRDQCILITGESGAGKTEASKLVMSYVAAVCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFG
KYMDIEFDFKGSPLGGVITNYLLEKSRVVKQLKGERNFHIFYQLLAGADAQLLSGHWGEEEGYGGPGYLRL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000150486 Myosin_head_motor_dom (28/672 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000150482 Myosin_head_motor_dom (39/672 aa) CDS CDS
ENSMUSE00000150468 Myosin_head_motor_dom (33/672 aa) CDS CDS
ENSMUSE00000150477 Myosin_head_motor_dom (36/672 aa) CDS CDS
ENSMUSE00000497342 Myosin_head_motor_dom (16/672 aa) CDS CDS
ENSMUSE00000150474 Myosin_head_motor_dom (22/672 aa) CDS CDS
ENSMUSE00000150469 Myosin_head_motor_dom (34/672 aa) CDS CDS
ENSMUSE00000150472 Myosin_head_motor_dom (35/672 aa) CDS Deleted
ENSMUSE00000150483 Myosin_head_motor_dom (50/672 aa) CDS Deleted
ENSMUSE00000150492 Myosin_head_motor_dom (40/672 aa) CDS Deleted
ENSMUSE00000150481 Myosin_head_motor_dom (29/672 aa) CDS Deleted
ENSMUSE00000150485 Myosin_head_motor_dom (22/672 aa) CDS CDS + stop codon + UTR
ENSMUSE00000150491 Myosin_head_motor_dom (35/672 aa) CDS
ENSMUSE00000498747 Myosin_head_motor_dom (21/672 aa) CDS
ENSMUSE00000150489 Myosin_head_motor_dom (67/672 aa) CDS
ENSMUSE00000150470 Myosin_head_motor_dom (76/672 aa) CDS
ENSMUSE00000274641 Myosin_head_motor_dom (68/672 aa) CDS
ENSMUSE00000150480 Myosin_head_motor_dom (29/672 aa) CDS
ENSMUSE00000150490 IQ_motif_EF-hand-BS (19/19 aa) CDS
ENSMUSE00000461869 IQ_motif_EF-hand-BS (14/21 aa) CDS
ENSMUSE00000488258 IQ_motif_EF-hand-BS (7/21 aa) CDS
ENSMUSE00000485967 CDS
ENSMUSE00000150479 Myosin_tail_2 (17/195 aa) CDS
ENSMUSE00000150473 Myosin_tail_2 (45/195 aa) CDS
ENSMUSE00000465187 Myosin_tail_2 (51/195 aa) CDS
ENSMUSE00000495387 Myosin_tail_2 (43/195 aa) CDS
ENSMUSE00000494000 Myosin_tail_2 (41/195 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0780_3_B08 PG00228_Z_4_C06 Myo1atm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0780_3_G05 PG00228_Z_4_C06 Myo1atm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0780_3_H07 PG00228_Z_4_C06 Myo1atm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0780_3_A05 PG00228_Z_4_C06 Myo1atm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0780_3_H08 PG00228_Z_4_C06 Myo1atm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0780_3_G08 PG00228_Z_4_C06 Myo1atm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 299848 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00228_Z_4_C06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 299848 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00228_Z_4_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 299848 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00228_Z_4_H06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
299848 Knockout-First - Reporter Tagged Insertion PCS00228_A_D09