IKMC Project Report - EUCOMM (ID: 72007)

Tbx20 MGI:1888496 ENSMUSG00000031965
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000052946 protein_coding No protein product (NMD) view

Predicted translation:

MEFTASPKPQLSSRANAFSIAALMSSGGPKEKEAAENTIKPLGSTCTQTPPLLASSSSNRWCLLKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000401288 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000215226 TF_T-box (25/188 aa) CDS Deleted
ENSMUSE00000215232 TF_T-box (56/188 aa) CDS Deleted
ENSMUSE00000215228 TF_T-box (37/188 aa) CDS CDS + stop codon + UTR
ENSMUSE00000215238 TF_T-box (53/188 aa) CDS
ENSMUSE00000403842 TF_T-box (19/188 aa) CDS
ENSMUSE00000363674 CDS
ENSMUSE00000406746 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166018 protein_coding No protein product (NMD) view

Predicted translation:

MEFTASPKPQLSSRANAFSIAALMSSGGPKEKEAAENTIKPLGSTCTQTPPLLASSSSNRWCLLKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000401288 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000215226 TF_T-box (25/188 aa) CDS Deleted
ENSMUSE00000215232 TF_T-box (56/188 aa) CDS Deleted
ENSMUSE00000215228 TF_T-box (37/188 aa) CDS CDS + stop codon + UTR
ENSMUSE00000215238 TF_T-box (53/188 aa) CDS
ENSMUSE00000403842 TF_T-box (19/188 aa) CDS
ENSMUSE00000894405 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available