IKMC Project Report - EUCOMM (ID: 72040)

Unc93b1 MGI:1859307 ENSMUSG00000036908 OTTMUSG00000034969
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000162708 protein_coding No protein product (NMD) view

Predicted translation:

MKEVPTSCWCPELQALDLDLVMEVEPPLYPVAGAAGPQGDEDRHGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLG
VVKNVLAASTGVTLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRCWACVEPL
TGPRKRSTCAAWAGATSSSCPSNTCVTFAYAIWCPSLSTVALRCSLPALVLPWATACAPWGWSDWHTCS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000858582 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000985482 CDS CDS
ENSMUSE00000241165 Ion_channel_UNC-93 (9/68 aa) CDS CDS
ENSMUSE00000241152 Ion_channel_UNC-93 (55/68 aa) CDS Deleted
ENSMUSE00000241126 Ion_channel_UNC-93 (6/68 aa) CDS Deleted
ENSMUSE00000241094 CDS Deleted
ENSMUSE00000241062 CDS Deleted
ENSMUSE00001052097 CDS CDS
ENSMUSE00001033900 CDS CDS + stop codon + UTR
ENSMUSE00000980469 CDS
ENSMUSE00000993910 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000165711 protein_coding No protein product (NMD) view

Predicted translation:

MKEVPTSCWCPELQALDLDLVMEVEPPLYPVAGAAGPQGDEDRHGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLG
VVKNVLAASTGVTLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRCWACVEPL
TGPRKRSTCAAWAGATSSSCPSNTCVTFAYAIWCPSLSTVALRCSLPALVLPCTPGHPI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000858582 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000985482 CDS CDS
ENSMUSE00000241165 Ion_channel_UNC-93 (9/68 aa) CDS CDS
ENSMUSE00000241152 Ion_channel_UNC-93 (55/68 aa) CDS Deleted
ENSMUSE00000241126 Ion_channel_UNC-93 (6/68 aa) CDS Deleted
ENSMUSE00000241094 CDS Deleted
ENSMUSE00000241062 CDS Deleted
ENSMUSE00001052097 CDS CDS
ENSMUSE00001046632 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001013353 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000161415 retained_intron No analysis available: incomplete transcript
ENSMUST00000162193 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 243596 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00190_Z_4_F06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 243596 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00190_Z_4_E01 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
243596 Knockout-First - Reporter Tagged Insertion PCS00190_A_D12