IKMC Project Report - EUCOMM (ID: 72046)
Serpinf2 MGI:107173 ENSMUSG00000038224 OTTMUSG00000006204
Mice no data available
Mutagenesis Predictions
This gene has 4 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000043696 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MALLRGLLVLSLSCLQGPCFTFSPVSAVDLPGQQPVSEQAQQKLPLPALFKLDNQDFGDHATLKRSPGHCKSVPTAEETR RLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGGSFPL*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000108437 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MALLRGLLVLSLSCLQGPCFTFSPVSAVDLPGQQPVSEQAQQKLPLPALFKLDNQDFGDHATLKRSPGHCKSVPTAEETR RLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGGSFPL*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000128330 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000142094 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0678_4_A07 | HTGR04015_Z_8_H03 | Serpinf2tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 255188 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04015_Z_8_H03 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 255188 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04015_Z_8_D06 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 255188 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04015_Z_8_D09 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 255188 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04015_Z_8_A06 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 255188 | Knockout First, Reporter-tagged insertion with conditional potential | PCS04015_A_H09 |