IKMC Project Report - EUCOMM (ID: 72220)

Eaf1 MGI:1921677 ENSMUSG00000021890
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022446 protein_coding No protein product (NMD) view

Predicted translation: 

MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000449475 Tscrpt_elong_fac_Eaf_N (22/102 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000121640 Tscrpt_elong_fac_Eaf_N (32/102 aa) CDS CDS
ENSMUSE00000121638 Tscrpt_elong_fac_Eaf_N (46/102 aa) CDS Deleted
ENSMUSE00000121645 Tscrpt_elong_fac_Eaf_N (4/102 aa) CDS Deleted
ENSMUSE00000121642 CDS CDS + stop codon + UTR
ENSMUSE00000121644 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 78944 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00090_Y_4_A10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 78944 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00090_Y_3_A10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 78944 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00090_Y_2_A11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
78944 Knockout-First - Reporter Tagged Insertion PCTS00090_A_A10