IKMC Project Report - KOMP-CSD (ID: 72317)

Cacna1i MGI:2178051 ENSMUSG00000022416 OTTMUSG00000034511
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
currently unavailable Genotype confirmed Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) EPD0807_2_A02 C57BL/6N;C57BL/6N;C57BL/6N-Atm1Brd/a view
( about ) 		BCM/
Southern Blot na TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000160424 protein_coding No protein product (NMD) view

Predicted translation: 

MADSNLPPSSSAAPDPEPGITEQPGPRSPPPSPPGLEEPLDGTNPDVPHPDLAPVAFFCLRQTTSPRNWCIKMVCNPWFE
CVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGM
VEYSLDLQNINLSAIRTVRVLRPLKAINRVPNKGMWPCPLTTNQKRTTRCPSSAPCRGTMALWAVTRSLHSRSRAESAAC
PKMTCTTSGRDAKTSTPAASASTGTATTTSAARATPTLTRAPSTLTTLAMPGS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000865236 UTR UTR
ENSMUSE00000863049 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000852042 CDS CDS
ENSMUSE00000557348 Ion_trans_dom (43/280 aa) CDS CDS
ENSMUSE00000507185 Ion_trans_dom (34/280 aa) CDS CDS
ENSMUSE00000557347 Ion_trans_dom (54/280 aa) CDS Deleted
ENSMUSE00000512639 Ion_trans_dom (106/280 aa) CDS CDS + stop codon + UTR
ENSMUSE00000511828 Ion_trans_dom (31/280 aa) CDS
ENSMUSE00000510780 Ion_trans_dom (15/280 aa) CDS
ENSMUSE00000517152 CDS
ENSMUSE00000557346 Ion_trans_dom (41/187 aa) CDS
ENSMUSE00000257367 Ion_trans_dom (63/187 aa) CDS
ENSMUSE00000257356 Ion_trans_dom (40/187 aa) CDS
ENSMUSE00000557345 Ion_trans_dom (45/187 aa) CDS
ENSMUSE00000680898 CDS
ENSMUSE00000680896 CDS
ENSMUSE00000467591 CDS
ENSMUSE00000257318 CDS
ENSMUSE00000557343 CDS
ENSMUSE00000647670 Ion_trans_dom (14/223 aa) CDS
ENSMUSE00000557341 Ion_trans_dom (62/223 aa) CDS
ENSMUSE00000647669 Ion_trans_dom (43/223 aa) CDS
ENSMUSE00000557339 Ion_trans_dom (42/223 aa) CDS
ENSMUSE00000647668 Ion_trans_dom (30/223 aa) CDS
ENSMUSE00000464849 Ion_trans_dom (33/223 aa) CDS
ENSMUSE00000499041 CDS
ENSMUSE00000482722 Ion_trans_dom (29/208 aa) CDS
ENSMUSE00000481755 Ion_trans_dom (46/208 aa) | PKD1_2_channel (6/144 aa) CDS
ENSMUSE00000557337 Ion_trans_dom (24/208 aa) | PKD1_2_channel (24/144 aa) CDS
ENSMUSE00000557336 Ion_trans_dom (27/208 aa) | PKD1_2_channel (27/144 aa) CDS
ENSMUSE00000501674 Ion_trans_dom (41/208 aa) | PKD1_2_channel (41/144 aa) CDS
ENSMUSE00000460811 Ion_trans_dom (44/208 aa) | PKD1_2_channel (48/144 aa) CDS
ENSMUSE00000680892 CDS
ENSMUSE00000680891 CDS
ENSMUSE00000966752 CDS
ENSMUSE00001079204 CDS
ENSMUSE00000869993 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000160175 protein_coding Target region does not overlap transcript
ENSMUST00000161863 protein_coding Target region does not overlap transcript
ENSMUST00000162025 protein_coding Target region does not overlap transcript
ENSMUST00000162155 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MADSNLPPSSSAAPDPEPGITEQPGPRSPPPSPPGLEEPLDGTNPDVPHPDLAPVAFFCLRQTTSPRNWCIKMVCNPWFE
CVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGM
VEYSLDLQNINLSAIRTVRVLRPLKAINRVPNKGMWPCPLTTNQKRTTRCPSSAPCRGTMALWAVTRSLHSRSRAESAAC
PKMTCTTSGRDAKTSTPAASASTGTATTTSAARATPTLTRAPSTLTTLAMPGS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000867709 UTR UTR
ENSMUSE00000863049 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000852042 CDS CDS
ENSMUSE00000557348 Ion_trans_dom (43/280 aa) CDS CDS
ENSMUSE00000507185 Ion_trans_dom (34/280 aa) CDS CDS
ENSMUSE00000557347 Ion_trans_dom (54/280 aa) CDS Deleted
ENSMUSE00000512639 Ion_trans_dom (106/280 aa) CDS CDS + stop codon + UTR
ENSMUSE00000511828 Ion_trans_dom (31/280 aa) CDS
ENSMUSE00000510780 Ion_trans_dom (15/280 aa) CDS
ENSMUSE00000517152 CDS
ENSMUSE00000557346 Ion_trans_dom (41/187 aa) CDS
ENSMUSE00000257367 Ion_trans_dom (63/187 aa) CDS
ENSMUSE00000257356 Ion_trans_dom (40/187 aa) CDS
ENSMUSE00000557345 Ion_trans_dom (45/187 aa) CDS
ENSMUSE00000680898 CDS
ENSMUSE00000680896 CDS
ENSMUSE00000467591 CDS
ENSMUSE00000257318 CDS
ENSMUSE00000557343 CDS
ENSMUSE00000647670 Ion_trans_dom (14/223 aa) CDS
ENSMUSE00000557341 Ion_trans_dom (62/223 aa) CDS
ENSMUSE00000647669 Ion_trans_dom (43/223 aa) CDS
ENSMUSE00000557339 Ion_trans_dom (42/223 aa) CDS
ENSMUSE00000647668 Ion_trans_dom (30/223 aa) CDS
ENSMUSE00000464849 Ion_trans_dom (33/223 aa) CDS
ENSMUSE00000499041 CDS
ENSMUSE00000482722 Ion_trans_dom (29/208 aa) CDS
ENSMUSE00000481755 Ion_trans_dom (46/208 aa) | PKD1_2_channel (6/144 aa) CDS
ENSMUSE00000557337 Ion_trans_dom (24/208 aa) | PKD1_2_channel (24/144 aa) CDS
ENSMUSE00000557336 Ion_trans_dom (27/208 aa) | PKD1_2_channel (27/144 aa) CDS
ENSMUSE00000501674 Ion_trans_dom (41/208 aa) | PKD1_2_channel (41/144 aa) CDS
ENSMUSE00000460811 Ion_trans_dom (44/208 aa) | PKD1_2_channel (48/144 aa) CDS
ENSMUSE00000680892 CDS
ENSMUSE00000860667 CDS + stop codon + UTR
ENSMUSE00001069724 UTR UTR
ENSMUSE00001019473 UTR UTR
ENSMUSE00000853390 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000162913 nonsense_mediated_decay Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0807_2_A02 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a pass Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_C04 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_D02 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_D03 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_D04 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_F04 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_G01 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_G02 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_G04 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_H01 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_H02 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_H03 PG00200_Z_3_E10 Cacna1itm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0807_2_A03 PG00200_Z_3_E10 Cacna1itm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_A04 PG00200_Z_3_E10 Cacna1itm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_F03 PG00200_Z_3_E10 Cacna1itm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0807_2_G03 PG00200_Z_3_E10 Cacna1itm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 237005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_3_E10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 237005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_6_E10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 237005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_7_E10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 237005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00200_A_E10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 237005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_8_E10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 237005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_5_E10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 237005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_2_E10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
237005 Knockout First, Reporter-tagged insertion with conditional potential PCTS00200_A_E10