IKMC Project Report - KOMP-CSD (ID: 73398)

0610011F06Rik MGI:1915597 ENSMUSG00000025731 OTTMUSG00000035873
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000026827 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLD

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000946481 DUF938 (65/203 aa) UTR + start codon + CDS
ENSMUSE00000256142 DUF938 (55/203 aa) CDS Deleted
ENSMUSE00000979700 DUF938 (20/203 aa) CDS Deleted
ENSMUSE00001004648 DUF938 (23/203 aa) CDS Deleted
ENSMUSE00000256064 DUF938 (27/203 aa) CDS Deleted
ENSMUSE00000256035 DUF938 (15/203 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000169308 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLD

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000909873 DUF938 (65/190 aa) UTR + start codon + CDS
ENSMUSE00000256142 DUF938 (55/190 aa) CDS Deleted
ENSMUSE00000979700 DUF938 (20/190 aa) CDS Deleted
ENSMUSE00001004648 DUF938 (23/190 aa) CDS Deleted
ENSMUSE00000895707 DUF938 (29/190 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000163356 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLDRFSDMEDREGGIEGG
*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000880189 DUF938 (65/165 aa) CDS CDS
ENSMUSE00000256142 DUF938 (55/165 aa) CDS Deleted
ENSMUSE00000979700 DUF938 (20/165 aa) CDS Deleted
ENSMUSE00001004648 DUF938 (23/165 aa) CDS Deleted
ENSMUSE00000895413 DUF938 (4/165 aa) CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000169085 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLD

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000880189 DUF938 (64/64 aa) CDS CDS + stop codon + UTR
ENSMUSE00000256064 DUF938 (26/41 aa) CDS Deleted
ENSMUSE00000879674 DUF938 (15/41 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000110456 nonsense_mediated_decay Residual N-terminal, unknown C-terminal view

Predicted translation:

MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLD

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000916485 DUF938 (65/65 aa) UTR + start codon + CDS
ENSMUSE00001041447 DUF938 (1/65 aa) CDS + stop codon + UTR Deleted
ENSMUSE00001030063 UTR Deleted
ENSMUSE00000908041 UTR Deleted
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available