IKMC Project Report - EUCOMM (ID: 74145)

F13b MGI:88379 ENSMUSG00000026368 OTTMUSG00000021467
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027615 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MMTLRHLPFILLLILSGELYAEEKQCDFPTVENGRIAQYYYTFKSFYFPMSVDKKLSFFCLAGYATESGKQEEQIRCTAE
GWSPNPRCYKKCLKPDLRNGYVSNDKVLYKLQERMSYGCSSGYKTTGGKDEEVVHCLSAGWSSQPSCRKEQENIENCKPP
PDIANGVVVDGLLASYTTGSSVEYRCNEYYLLKGSETSRCEQGAWSSPPVCLEPCTIDVDHMNRNNIQLKWKYEGKILHG
DLIDFVCKQGYNLSPSIPLSEISAQCNRGDVRYPMCIRKESKGMCASPPVIRNGDIVSSAARTYENGSSVEYRCFDNHFL
QGSQNVYCVDGVWTTPPSCLEPCTLSFVEMDKNYLQLKWNFDNRPLILHGEYIEFMCKRDAYISETSIAGSVLRVQCDRG
RLKYPKCTPRDRRLSFQEALRTRRQMEKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001037401 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000972252 Sushi_SCR_CCP (41/41 aa) CDS CDS
ENSMUSE00000158491 Sushi_SCR_CCP (56/56 aa) CDS CDS
ENSMUSE00000158485 Sushi_SCR_CCP (56/56 aa) CDS Deleted
ENSMUSE00000158492 Sushi_SCR_CCP (55/55 aa) CDS Deleted
ENSMUSE00000280485 Sushi_SCR_CCP (54/54 aa) CDS Deleted
ENSMUSE00000280480 Sushi_SCR_CCP (54/54 aa) CDS Deleted
ENSMUSE00000158488 Sushi_SCR_CCP (55/55 aa) CDS CDS
ENSMUSE00000158489 CDS CDS
ENSMUSE00001013067 Sushi_SCR_CCP (55/55 aa) CDS CDS
ENSMUSE00000158490 CDS CDS
ENSMUSE00000394188 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000139080 processed_transcript No analysis available: incomplete transcript
ENSMUST00000141842 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available