IKMC Project Report - KOMP-CSD (ID: 74463)

Isyna1 MGI:1919030 ENSMUSG00000019139
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000019283 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MEPAAEILVDSPDVVYSPETIEARYEYRTTRVSREGGVLRGLRGAPAPEPHAIRAQDGASRPRHQARRGGGHQPTALQER
AHTCHQWLHRRCQWAPAGTNTKAVHCLNQVTGPDPSTPNASNHSTSALAKDNKASLK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000581981 UTR UTR
ENSMUSE00000382178 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000435893 Myo-inos-1-P_Synthase (35/433 aa) CDS Deleted
ENSMUSE00000342614 Myo-inos-1-P_Synthase (45/433 aa) CDS Deleted
ENSMUSE00000213733 Myo-inos-1-P_Synthase (65/433 aa) CDS Deleted
ENSMUSE00000213732 Myo-inos-1-P_Synthase (50/433 aa) CDS Deleted
ENSMUSE00000213734 Myo-inos-1-P_Synthase (72/433 aa) | Myo-inos-1-P_Synthase_GAPDH (18/114 aa) CDS Deleted
ENSMUSE00000213730 Myo-inos-1-P_Synthase (55/433 aa) | Myo-inos-1-P_Synthase_GAPDH (55/114 aa) CDS Deleted
ENSMUSE00000373289 Myo-inos-1-P_Synthase (38/433 aa) | Myo-inos-1-P_Synthase_GAPDH (38/114 aa) CDS Deleted
ENSMUSE00000388575 Myo-inos-1-P_Synthase (73/433 aa) | Myo-inos-1-P_Synthase_GAPDH (3/114 aa) CDS Deleted
ENSMUSE00000347693 Myo-inos-1-P_Synthase (2/433 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available