IKMC Project Report - KOMP-CSD (ID: 74848)

Insig2 MGI:1920249 ENSMUSG00000003721 OTTMUSG00000034839
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 13 wild type transcripts, of which 10 are protein-coding. Following removal of the floxed region, 10 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000003818 protein_coding No protein product (NMD) view

Predicted translation: 

MAEGETESPRPKKCGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVITSIFSSAWWVPPCCGTA
SESRLRQQLPVFPHTGCTVSRTVVDF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000868541 UTR UTR
ENSMUSE00000158179 INSIG_fam (53/183 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000158178 INSIG_fam (42/183 aa) CDS Deleted
ENSMUSE00001053098 INSIG_fam (56/183 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077204 INSIG_fam (34/183 aa) CDS
ENSMUSE00000342462 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000071064 protein_coding No protein product (NMD) view

Predicted translation: 

MAEGETESPRPKKCGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVITSIFSSAWWVPPCCGTA
SESRLRQQLPVFPHTGCTVSRTVVDF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000432306 UTR UTR
ENSMUSE00000158179 INSIG_fam (53/183 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000158178 INSIG_fam (42/183 aa) CDS Deleted
ENSMUSE00001053098 INSIG_fam (56/183 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077204 INSIG_fam (34/183 aa) CDS
ENSMUSE00000870502 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159085 protein_coding No protein product (NMD) view

Predicted translation: 

MAEGETESPRPKKCGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVITSIFSSAWWVPPCCGTA
SESRLRQQLPVFPHTGCTVSRTVVDF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000870541 UTR UTR
ENSMUSE00000856135 INSIG_fam (53/183 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000158178 INSIG_fam (42/183 aa) CDS Deleted
ENSMUSE00001053098 INSIG_fam (56/183 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077204 INSIG_fam (34/183 aa) CDS
ENSMUSE00000868941 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000160968 protein_coding No protein product (NMD) view

Predicted translation: 

MAEGETESPRPKKCGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVITSIFSSAWWVPPCCGTA
SESRLRQQLPVFPHTGCTVSRTVVDF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000869170 UTR UTR
ENSMUSE00000158179 INSIG_fam (53/183 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000158178 INSIG_fam (42/183 aa) CDS Deleted
ENSMUSE00001053098 INSIG_fam (56/183 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077204 INSIG_fam (34/183 aa) CDS
ENSMUSE00000864294 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162790 protein_coding No analysis available: incomplete transcript
ENSMUST00000162582 protein_coding No analysis available: incomplete transcript
ENSMUST00000160688 protein_coding Design floxes no exons in transcript ENSMUST00000160688
ENSMUST00000159125 protein_coding Target region does not overlap transcript
ENSMUST00000161818 protein_coding Target region does not overlap transcript
ENSMUST00000161068 protein_coding Target region does not overlap transcript
ENSMUST00000162019 retained_intron No analysis available: incomplete transcript
ENSMUST00000159192 retained_intron No analysis available: incomplete transcript
ENSMUST00000159528 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0824_2_A09 PG00200_Z_1_E03 Insig2tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0824_2_A10 PG00200_Z_1_E03 Insig2tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0824_2_H10 PG00200_Z_1_E03 Insig2tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0824_2_D10 PG00200_Z_1_E03 Insig2tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00200_Z_3_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00200_Z_4_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00200_Z_1_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00200_Z_8_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00200_Z_2_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00200_A_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00200_Z_6_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 182244 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00200_Z_7_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
182244 Knockout-First - Reporter Tagged Insertion PCTS00200_A_E03