IKMC Project Report - EUCOMM (ID: 74975)

Eif2s3y MGI:1349430 ENSMUSG00000069049 OTTMUSG00000021559
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000091197 protein_coding No protein product (NMD) view

Predicted translation: 

MAGGEAGVTLGQPHLSRQDLATLDVTKLTPLSREIISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIK
LGYANAKIYKLDDSSCPRPECYRSCGSSTPDEFPSDIPGTKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIA
GNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGGTRDRSETWYCF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000773651 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000975241 ProtSyn_GTP-bd (5/205 aa) CDS CDS
ENSMUSE00001020574 ProtSyn_GTP-bd (43/205 aa) CDS CDS
ENSMUSE00001046154 ProtSyn_GTP-bd (41/205 aa) CDS CDS
ENSMUSE00001011787 ProtSyn_GTP-bd (33/205 aa) CDS CDS
ENSMUSE00000980073 ProtSyn_GTP-bd (54/205 aa) CDS CDS
ENSMUSE00000568614 ProtSyn_GTP-bd (33/205 aa) CDS Deleted
ENSMUSE00000568611 Transl_elong_EFTu/EF1A_2 (13/84 aa) CDS Deleted
ENSMUSE00000568610 Transl_elong_EFTu/EF1A_2 (49/84 aa) CDS CDS + stop codon + UTR
ENSMUSE00001057704 TIF2_gsu_C (26/92 aa) | Transl_elong_EFTu/EF1A_2 (23/84 aa) CDS
ENSMUSE00001056881 TIF2_gsu_C (58/92 aa) CDS
ENSMUSE00000789510 TIF2_gsu_C (9/92 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000148961 retained_intron No analysis available: incomplete transcript
ENSMUST00000137006 retained_intron Target region does not overlap transcript
ENSMUST00000144042 retained_intron No analysis available: incomplete transcript
ENSMUST00000134820 retained_intron Target region does not overlap transcript
ENSMUST00000139083 processed_transcript No analysis available: incomplete transcript
ENSMUST00000154556 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0635_3_H04 HTGR03001_Z_3_H03 Eif2s3ytm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 40520 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03001_Z_3_H03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 40520 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03016_Z_3_C12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 40520 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03016_Z_3_H01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 40520 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03001_Z_3_B11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 40520 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03016_Z_3_B04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
40520 Knockout First, Reporter-tagged insertion with conditional potential PCS03001_A_C06
40520 Knockout First, Reporter-tagged insertion with conditional potential PCS03016_A_C05