IKMC Project Report - EUCOMM (ID: 75114)

Dmwd MGI:94907 ENSMUSG00000030410 OTTMUSG00000022947
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000032570 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MAAGGAEGGPGPSAAMGDCAEIKSQFRTREGFYKLLPGDATRRSGPTSAQTPAPPQPTQPPPGPAAASGPGAAGPASSPP
PAGPGPGPALPAVRLSLVRLGDPDGAGEPPSTPSGLGAGGDRVCFNLGRELYFYPGCCRSGSQRSIDLNKPIDKRIYKGT
QPTCHDFNQFTAATETISLLVGFSAGQVQYLDLIKKDTSKLFNEEFTDEETEAQAGQASWPRSPSKSVVEGISSQPGSSP
SGTVV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000676908 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000198585 CDS CDS
ENSMUSE00000972488 WD40_repeat (36/36 aa) | WD40_repeat (25/25 aa) | WD40_repeat (34/34 aa) CDS Deleted
ENSMUSE00001063690 CDS CDS
ENSMUSE00000412301 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108479 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MAAGGAEGGPGPSAAMGDCAEIKSQFRTREGFYKLLPGDATRRSGPTSAQTPAPPQPTQPPPGPAAASGPGAAGPASSPP
PAGPGPGPALPAVRLSLVRLGDPDGAGEPPSTPSGLGAGGDRVCFNLGRELYFYPGCCRSGSQRSIDLNKPIDKRIYKGT
QPTCHDFNQFTAATETISLLVGFSAGQVQYLDLIKKDTSKLFNEEGISSQPGSSPSGTVV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000235688 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000198585 CDS CDS
ENSMUSE00000972488 WD40_repeat (36/36 aa) | WD40_repeat (25/25 aa) | WD40_repeat (34/34 aa) CDS Deleted
ENSMUSE00000412301 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000146429 processed_transcript No analysis available: incomplete transcript
ENSMUST00000138997 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0776_5_E07 HTGR03002_Z_2_A10 Dmwdtm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_5_G05 HTGR03002_Z_2_A10 Dmwdtm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_5_B06 HTGR03002_Z_2_A10 Dmwdtm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_5_D06 HTGR03002_Z_2_A10 Dmwdtm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_5_E05 HTGR03002_Z_2_A10 Dmwdtm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_A10 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_E12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_H11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_A11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_F11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_A12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03002_Z_2_D03 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
42869 Knockout-First - Reporter Tagged Insertion PCS03002_A_B02