IKMC Project Report - EUCOMM (ID: 75312)

Fgfr3 MGI:95524 ENSMUSG00000054252 OTTMUSG00000021524
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 11 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000114411 protein_coding No protein product (NMD) view

Predicted translation:

MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLV
ASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTVLDQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000654338 UTR UTR
ENSMUSE00000654337 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001085950 Immunoglobulin (57/57 aa) CDS CDS
ENSMUSE00001055792 CDS CDS
ENSMUSE00001004611 Ig_I-set (38/79 aa) | Immunoglobulin (35/61 aa) CDS Deleted
ENSMUSE00001092700 Ig_I-set (41/79 aa) | Immunoglobulin (26/61 aa) CDS Deleted
ENSMUSE00000600781 Ig_I-set (50/96 aa) CDS Deleted
ENSMUSE00000699240 Ig_I-set (46/96 aa) CDS CDS + stop codon + UTR
ENSMUSE00001061359 CDS
ENSMUSE00000417936 CDS
ENSMUSE00000417928 Ser-Thr/Tyr_kinase_cat_dom (40/277 aa) | Prot_kinase_cat_dom (39/275 aa) CDS
ENSMUSE00001076313 Ser-Thr/Tyr_kinase_cat_dom (38/277 aa) | Prot_kinase_cat_dom (38/275 aa) CDS
ENSMUSE00001091448 Ser-Thr/Tyr_kinase_cat_dom (64/277 aa) | Prot_kinase_cat_dom (64/275 aa) CDS
ENSMUSE00000548223 Ser-Thr/Tyr_kinase_cat_dom (41/277 aa) | Prot_kinase_cat_dom (41/275 aa) CDS
ENSMUSE00000548217 Ser-Thr/Tyr_kinase_cat_dom (24/277 aa) | Prot_kinase_cat_dom (24/275 aa) CDS
ENSMUSE00000417898 Ser-Thr/Tyr_kinase_cat_dom (47/277 aa) | Prot_kinase_cat_dom (47/275 aa) CDS
ENSMUSE00001093361 Ser-Thr/Tyr_kinase_cat_dom (27/277 aa) | Prot_kinase_cat_dom (26/275 aa) CDS
ENSMUSE00000654303 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000171509 protein_coding No analysis available: incomplete transcript
ENSMUST00000067150 protein_coding No protein product (NMD) view

Predicted translation:

MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLV
ASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTDCRR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000654338 UTR UTR
ENSMUSE00000654337 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001085950 Immunoglobulin (57/57 aa) CDS CDS
ENSMUSE00001055792 CDS CDS
ENSMUSE00001004611 Ig_I-set (38/79 aa) | Immunoglobulin (35/61 aa) CDS Deleted
ENSMUSE00001092700 Ig_I-set (41/79 aa) | Immunoglobulin (26/61 aa) CDS Deleted
ENSMUSE00000600781 Ig_I-set (50/97 aa) | Immunoglobulin (42/73 aa) CDS Deleted
ENSMUSE00001061512 Ig_I-set (47/97 aa) | Immunoglobulin (31/73 aa) CDS CDS + stop codon + UTR
ENSMUSE00001061359 CDS
ENSMUSE00000654322 CDS
ENSMUSE00000417928 Ser-Thr/Tyr_kinase_cat_dom (40/277 aa) | Prot_kinase_cat_dom (39/275 aa) CDS
ENSMUSE00001076313 Ser-Thr/Tyr_kinase_cat_dom (38/277 aa) | Prot_kinase_cat_dom (38/275 aa) CDS
ENSMUSE00001091448 Ser-Thr/Tyr_kinase_cat_dom (64/277 aa) | Prot_kinase_cat_dom (64/275 aa) CDS
ENSMUSE00000548223 Ser-Thr/Tyr_kinase_cat_dom (41/277 aa) | Prot_kinase_cat_dom (41/275 aa) CDS
ENSMUSE00000548217 Ser-Thr/Tyr_kinase_cat_dom (24/277 aa) | Prot_kinase_cat_dom (24/275 aa) CDS
ENSMUSE00000417898 Ser-Thr/Tyr_kinase_cat_dom (47/277 aa) | Prot_kinase_cat_dom (47/275 aa) CDS
ENSMUSE00001093361 Ser-Thr/Tyr_kinase_cat_dom (27/277 aa) | Prot_kinase_cat_dom (26/275 aa) CDS
ENSMUSE00000809422 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000169212 protein_coding No protein product (NMD) view

Predicted translation:

MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLV
ASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTDCRR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000991227 UTR UTR
ENSMUSE00000654337 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001085950 Immunoglobulin (57/57 aa) CDS CDS
ENSMUSE00001055792 CDS CDS
ENSMUSE00001004611 Ig_I-set (38/79 aa) | Immunoglobulin (35/61 aa) CDS Deleted
ENSMUSE00001092700 Ig_I-set (41/79 aa) | Immunoglobulin (26/61 aa) CDS Deleted
ENSMUSE00000600781 Ig_I-set (50/97 aa) | Immunoglobulin (42/73 aa) CDS Deleted
ENSMUSE00001061512 Ig_I-set (47/97 aa) | Immunoglobulin (31/73 aa) CDS CDS + stop codon + UTR
ENSMUSE00001061359 CDS
ENSMUSE00000417936 CDS
ENSMUSE00000417928 Ser-Thr/Tyr_kinase_cat_dom (40/277 aa) | Prot_kinase_cat_dom (39/275 aa) CDS
ENSMUSE00001076313 Ser-Thr/Tyr_kinase_cat_dom (38/277 aa) | Prot_kinase_cat_dom (38/275 aa) CDS
ENSMUSE00001091448 Ser-Thr/Tyr_kinase_cat_dom (64/277 aa) | Prot_kinase_cat_dom (64/275 aa) CDS
ENSMUSE00000548223 Ser-Thr/Tyr_kinase_cat_dom (41/277 aa) | Prot_kinase_cat_dom (41/275 aa) CDS
ENSMUSE00000548217 Ser-Thr/Tyr_kinase_cat_dom (24/277 aa) | Prot_kinase_cat_dom (24/275 aa) CDS
ENSMUSE00000417898 Ser-Thr/Tyr_kinase_cat_dom (47/277 aa) | Prot_kinase_cat_dom (47/275 aa) CDS
ENSMUSE00001093361 Ser-Thr/Tyr_kinase_cat_dom (27/277 aa) | Prot_kinase_cat_dom (26/275 aa) CDS
ENSMUSE00000654303 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000087820 protein_coding No analysis available: incomplete transcript
ENSMUST00000164207 protein_coding No analysis available: incomplete transcript
ENSMUST00000155002 protein_coding No analysis available: incomplete transcript
ENSMUST00000134610 retained_intron No analysis available: incomplete transcript
ENSMUST00000132724 retained_intron No analysis available: incomplete transcript
ENSMUST00000152661 retained_intron Target region does not overlap transcript
ENSMUST00000142860 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 40496 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00030_C_1_F04 L1L2_gt1 L3L4_pZero_DTA_kan view
order 40496 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00030_C_2_F04 L1L2_gt1 L3L4_pZero_DTA_kan view
order 40496 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00030_C_3_F04 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
40496 Knockout First, Reporter-tagged insertion with conditional potential PCS00030_B_F05