This gene has 2 wild type transcripts,
of which 1 are protein-coding.
Following removal of the floxed region, 1
transcript is
predicted to produce a truncated protein product of which
1 may be subject to non-sense mediated decay (NMD).
The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below
shows the predicted structure of the gene transcripts after application of Flp and Cre
(forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found
here).
Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id |
Ensembl Biotype |
Floxed transcript description |
Details |
|
ENSMUST00000002925
|
protein_coding |
No protein product (NMD) |
view
|
|
Predicted translation:
MGAPPPAPRSRLCGAWGPFPRVFAAGAVAADSPGFVEDREQRSGVSDPGSLESGWDRLRQLFAKDKVHTVLPQGASSGMA
GAGVGELQFS*
| Legend: |
|
in frame |
|
deleted |
|
frameshifted |
|
|
ENSMUST00000147543
|
processed_transcript |
No analysis available: incomplete transcript |
|
show/hide more transcripts