IKMC Project Report - EUCOMM (ID: 75664)

Mis18a MGI:1913828 ENSMUSG00000022978 OTTMUSG00000019967
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000099554 protein_coding No protein product (NMD) view

Predicted translation: 

MSSESPLLEKRLSEDSSRYLRLQKWANMSSADALGLEKERPEEKAAAAENPLVFLCARCRRPLGDSLTWVASQEDTNCIL
LRTSLRRCTARAAPSALAMCTDALLRTWTTSATCSASALKPLKVTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000471618 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000964669 CDS Deleted
ENSMUSE00001089769 CDS CDS
ENSMUSE00000132301 CDS CDS + stop codon + UTR
ENSMUSE00000642316 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000129171 retained_intron No analysis available: incomplete transcript
ENSMUST00000147546 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0654_1_C02 HTGR03003_Z_5_D06 Mis18atm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47783 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03003_Z_5_H01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 47783 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03003_Z_5_D06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47783 Knockout First, Reporter-tagged insertion with conditional potential PCS03003_A_E02