IKMC Project Report - KOMP-CSD (ID: 75736)

Lrriq1 MGI:1922228 ENSMUSG00000019892 OTTMUSG00000032477
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000020043 protein_coding No protein product (NMD) view

Predicted translation: 

MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYINVIKNKSKTAEELILQDVED
TDIFSDYKKDIICNRKGRIYEKSSSFCQVCFRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000098851 UTR UTR
ENSMUSE00000098850 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000098844 CDS CDS
ENSMUSE00000098842 CDS Deleted
ENSMUSE00000098840 CDS CDS + stop codon + UTR
ENSMUSE00000098841 CDS
ENSMUSE00000098846 CDS
ENSMUSE00000640682 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166240 protein_coding No protein product (NMD) view

Predicted translation: 

MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYINVIKNKSKTAEELILQDVED
TDIFSDYKKDIICNRKGRIYEKSSSFCQVCFRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000098851 UTR UTR
ENSMUSE00000098850 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000098844 CDS CDS
ENSMUSE00000098842 CDS Deleted
ENSMUSE00000098840 CDS CDS + stop codon + UTR
ENSMUSE00000098841 CDS
ENSMUSE00000098846 CDS
ENSMUSE00000892300 CDS
ENSMUSE00000904046 CDS
ENSMUSE00000881075 Leu-rich_rpt (15/21 aa) CDS
ENSMUSE00000902399 Leu-rich_rpt (7/21 aa) CDS
ENSMUSE00000882812 CDS
ENSMUSE00000884880 CDS
ENSMUSE00000894305 CDS
ENSMUSE00000878253 CDS
ENSMUSE00000912410 CDS
ENSMUSE00000899662 IQ_motif_EF-hand-BS (19/19 aa) | IQ_motif_EF-hand-BS (7/19 aa) CDS
ENSMUSE00000873346 IQ_motif_EF-hand-BS (12/19 aa) CDS
ENSMUSE00000894506 CDS
ENSMUSE00000912682 CDS
ENSMUSE00000884295 CDS
ENSMUSE00000894442 CDS
ENSMUSE00000874845 CDS
ENSMUSE00000907529 CDS
ENSMUSE00000878840 CDS
ENSMUSE00000879482 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123364 protein_coding No protein product (NMD) view

Predicted translation: 

MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYINVIKNKSKTAEELILQDVED
TDIFSDYKKDIICNRKGRIYEKSSSFCQVCFRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000772389 UTR UTR
ENSMUSE00000098850 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000098844 CDS CDS
ENSMUSE00000098842 CDS Deleted
ENSMUSE00000098840 CDS CDS + stop codon + UTR
ENSMUSE00000098841 CDS
ENSMUSE00000098846 CDS
ENSMUSE00000782103 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0729_4_E12 HTGRS06017_A_G06 Lrriq1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0729_4_H09 HTGRS06017_A_G06 Lrriq1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0729_4_B12 HTGRS06017_A_G06 Lrriq1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_7_G06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_1_F06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_5_F06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_5_G06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_1_G06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS06017_A_G06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_8_G06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_3_G06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_3_F06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88150 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06017_A_2_F06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
88150 Knockout-First - Reporter Tagged Insertion PCS06017_A_G06
88150 Knockout-First - Reporter Tagged Insertion PCS00085_C_C05