IKMC Project Report - EUCOMM (ID: 75904)

Jag1 MGI:1095416 ENSMUSG00000027276 OTTMUSG00000015560
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000028735 protein_coding No protein product (NMD) view

Predicted translation: 

MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLK
EYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIRASTVGRACTATSA
SRTQDVSTAPAMNPGSASVRPTGVDSSVTKI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000393627 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000167816 Notch_ligand_N (80/80 aa) CDS CDS
ENSMUSE00000290024 CDS CDS
ENSMUSE00000290014 DSL (63/63 aa) CDS Deleted
ENSMUSE00000167847 CDS Deleted
ENSMUSE00000557868 CDS CDS
ENSMUSE00000167823 EGF-like_dom (33/33 aa) | EGF_extracell (30/30 aa) CDS CDS + stop codon + UTR
ENSMUSE00000167855 EGF-like_dom (31/31 aa) | EGF_extracell (32/32 aa) CDS
ENSMUSE00000167852 EGF-like_dom (31/31 aa) | EGF_extracell (32/32 aa) CDS
ENSMUSE00000167845 EGF-like_dom (3/37 aa) | EGF-like_Ca-bd (34/34 aa) CDS
ENSMUSE00000167810 EGF-like_dom (16/37 aa) | EGF_extracell (8/28 aa) CDS
ENSMUSE00000167827 EGF-like_dom (19/37 aa) | EGF-like_dom (29/29 aa) | EGF_extracell (20/28 aa) | EGF_extracell (32/32 aa) | EGF-like_Ca-bd (32/32 aa) CDS
ENSMUSE00000167837 EGF-like_dom (31/31 aa) CDS
ENSMUSE00000167826 EGF_extracell (30/30 aa) CDS
ENSMUSE00000167863 EGF-like_dom (31/31 aa) | EGF_extracell (32/32 aa) CDS
ENSMUSE00000167834 EGF-like_dom (31/31 aa) | EGF_extracell (32/32 aa) CDS
ENSMUSE00000167849 EGF_extracell (32/32 aa) CDS
ENSMUSE00000167843 EGF-like_dom (30/30 aa) | EGF_extracell (32/32 aa) CDS
ENSMUSE00000167814 EGF-like_dom (5/30 aa) CDS
ENSMUSE00000167844 EGF-like_dom (26/30 aa) CDS
ENSMUSE00000557848 EGF-like_dom (30/30 aa) CDS
ENSMUSE00000984753 CDS
ENSMUSE00000167831 CDS
ENSMUSE00000167818 CDS
ENSMUSE00001012132 CDS
ENSMUSE00000478194 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000133640 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 256189 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00197_Z_5_G11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 256189 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00197_Z_5_F03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
256189 Knockout-First - Reporter Tagged Insertion PCS00197_A_E07