IKMC Project Report - EUCOMM (ID: 76455)

R3hdm4 MGI:1924814 ENSMUSG00000035781
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000045628 protein_coding Novel C-terminal product view

Predicted translation: 

MMAEPLPAASPGPDLCLLIRSSTLSEFECHPFPSGIPLPLPLHVPDHTGRPCSSPPWYLYLGRET*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000450080 UTR + start codon + CDS
ENSMUSE00000360384 CDS Deleted
ENSMUSE00000314697 CDS Deleted
ENSMUSE00000314690 CDS Deleted
ENSMUSE00000314683 CDS Deleted
ENSMUSE00000314674 CDS Deleted
ENSMUSE00000314668 CDS Deleted
ENSMUSE00000362230 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000171416 protein_coding No protein product (NMD) view

Predicted translation: 

MMAEPLPAASPGPDLCLLIRSSTLSEFECHPFPSGIPLPLPLHVPDHTGRPCSSPPWYLYLGRET*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000878623 UTR + start codon + CDS
ENSMUSE00000360384 CDS Deleted
ENSMUSE00000314697 CDS Deleted
ENSMUSE00000314690 CDS Deleted
ENSMUSE00000314683 CDS Deleted
ENSMUSE00000314674 CDS Deleted
ENSMUSE00000314668 CDS Deleted
ENSMUSE00000872882 CDS + stop codon + UTR
ENSMUSE00000687330 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0668_4_F09 PG00196_Z_5_F03 R3hdm4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_F03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_E04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_A09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_F07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_A08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_B04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_F10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_A11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_H11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_E06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 257994 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00196_Z_5_C03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
257994 Knockout First, Reporter-tagged insertion with conditional potential PCS00196_A_E05