IKMC Project Report - EUCOMM (ID: 76695)

Wbp4 MGI:109568 ENSMUSG00000022023
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022601 protein_coding No protein product (NMD) view

Predicted translation:

MADYWKSQPKKFCDYCKCWIADNRPTFQSQLYHQSSALSNPPLRQINRKRRKRRRRRKKLQRVDGWKA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000447775 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000123036 Znf_U1-C (17/36 aa) CDS CDS
ENSMUSE00000123034 Znf_U1-C (19/36 aa) CDS Deleted
ENSMUSE00000123033 CDS Deleted
ENSMUSE00000123030 WW_Rsp5_WWP (22/29 aa) CDS CDS + stop codon + UTR
ENSMUSE00000123037 WW_Rsp5_WWP (8/29 aa) CDS
ENSMUSE00000123032 WW_Rsp5_WWP (19/26 aa) CDS
ENSMUSE00000123031 WW_Rsp5_WWP (8/26 aa) CDS
ENSMUSE00000123029 CDS
ENSMUSE00000647202 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available