IKMC Project Report - KOMP-CSD (ID: 76952)

Gm15091 MGI:3712222 ENSMUSG00000095082 OTTMUSG00000018981
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000112740 protein_coding No protein product (NMD) view

Predicted translation: 

MANHEDEIRQLRYLEAANSEKEYNEENDIQSESSRGQAFFRGHPRGRDKTSQPRKSNKEEWKPIRRETATTRKNPIVLQE
FTWPLPIS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001029560 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001019323 CDS CDS
ENSMUSE00001070408 CDS Deleted
ENSMUSE00001053732 CDS CDS + stop codon + UTR
ENSMUSE00001014132 CDS
ENSMUSE00001057245 CDS
ENSMUSE00000974250 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0601_5_F08 PRPGS00115_B_H03 Gm15091tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0601_5_A06 PRPGS00115_B_H03 Gm15091tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_7_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_4_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_6_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_2_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_8_H02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_8_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_1_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_3_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111739 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00115_B_H03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
111739 Knockout First, Reporter-tagged insertion with conditional potential PCS00115_C_H03