IKMC Project Report - KOMP-CSD (ID: 76956)

Rhox1 MGI:3580237 ENSMUSG00000071773 OTTMUSG00000017122
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000115210 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MVVTRGKGHRSHRAALAFGCHTNKIRETFLWLKNLGKLTYTENGWQCVCVCVKPKCRIGFKGEEQNIGNIIIHKQRLRGV
PPPDKHITFP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000858150 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000702065 CDS Deleted
ENSMUSE00000624300 Homeodomain (24/52 aa) CDS Deleted
ENSMUSE00000624299 Homeodomain (16/52 aa) CDS CDS
ENSMUSE00000656296 Homeodomain (13/52 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 111526 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_6_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111526 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_1_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111526 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_2_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111526 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Y_8_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 111526 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00115_B_E03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
111526 Knockout First, Reporter-tagged insertion with conditional potential PCS00115_C_E03