IKMC Project Report - EUCOMM (ID: 77111)

1700112E06Rik MGI:1923883 ENSMUSG00000063458 OTTMUSG00000034628
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000075639 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAGLMVSGTQVSYVGQSCREIPEHLGRDFGHFAKRLDLSFNLLRSLEGLSAFRSLEELILDNNLLGDDLVLPGLPHLHTL
TLNKNQITDLEYLLDHLAEVTPSLEYLSLLGNVACPNELVNLEKDEEDYKRYRLPVRRRRLLLLRTSPSTHPCLLDPEIS
PVIEASSGKVAIFTMEEIQRVTGLSEMISSEAKLCTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000856224 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000465702 CDS CDS
ENSMUSE00001013165 CDS CDS
ENSMUSE00001008024 CDS CDS
ENSMUSE00001054297 CDS Deleted
ENSMUSE00000520101 CDS CDS
ENSMUSE00001036953 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162540 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAGLMVSGTQVSYVGQSCREIPEHLGRDFGHFAKRLDLSFNLLRSLEGLSAFRSLEELILDNNLLGDDLVLPGLPHLHTL
TLNKNQITDLEYLLDHLAEVTPSLEYLSLLGNVACPNELVNLEKDEEDYKRYSIMSAACCHVPTVMIMD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000462700 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000465702 CDS CDS
ENSMUSE00001013165 CDS CDS
ENSMUSE00001008024 CDS CDS
ENSMUSE00001054297 CDS Deleted
ENSMUSE00000850080 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000967698 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000159777 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAGLMVSGTQVSYVGQSCREIPEHLGRDFGHFAKRLDLSFNLLRSLEGLSAFRSLEELILDNNLLGDDLVLPGLPHLHTL
TLNKNQITDLEYLLDHLAEVTPSLEYLSLLGNVACPNELVNLEKDEEDYKRYSRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000462700 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000465702 CDS CDS
ENSMUSE00001013165 CDS CDS
ENSMUSE00001008024 CDS CDS
ENSMUSE00001054297 CDS Deleted
ENSMUSE00000871313 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000161249 protein_coding No analysis available: incomplete transcript
ENSMUST00000162337 processed_transcript No analysis available: incomplete transcript
ENSMUST00000159107 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0776_1_H08 HTGR04003_Z_7_H09 1700112E06Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_1_G07 HTGR04003_Z_7_H09 1700112E06Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_1_A07 HTGR04003_Z_7_H09 1700112E06Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_1_A06 HTGR04003_Z_7_H09 1700112E06Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0776_1_H07 HTGR04003_Z_7_H09 1700112E06Riktm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0776_1_G05 HTGR04003_Z_7_H09 1700112E06Riktm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 238960 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04003_Z_7_H09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
238960 Knockout First, Reporter-tagged insertion with conditional potential PCS04003_A_G07