IKMC Project Report - EUCOMM (ID: 77112)

Slc39a3 MGI:2147269 ENSMUSG00000046822 OTTMUSG00000030300
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000117276 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MTKLLVAKVLCMVGVFFFMLLGSLLPVKVIEADLEKAHRSKKVLSLCNTFGGGVFLATCFNALLPAVRDK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000841554 UTR UTR
ENSMUSE00000433603 UTR UTR
ENSMUSE00000362524 ZIP (63/304 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000402979 ZIP (241/304 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000059551 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MTKLLVAKVLCMVGVFFFMLLGSLLPVKVIEADLEKAHRSKKVLSLCNTFGGGVFLATCFNALLPAVRDK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000720847 UTR UTR
ENSMUSE00000718792 UTR UTR
ENSMUSE00000362524 ZIP (63/304 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000719004 ZIP (241/304 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000168076 protein_coding No analysis available: incomplete transcript
ENSMUST00000152177 processed_transcript Target region does not overlap transcript
ENSMUST00000154877 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 48766 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04003_Z_2_G06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
48766 Knockout First, Reporter-tagged insertion with conditional potential PCS04003_A_B03