IKMC Project Report - KOMP-CSD (ID: 77476)

Isl1 MGI:101791 ENSMUSG00000042258 OTTMUSG00000039739
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000036060 protein_coding No protein product (NMD) view

Predicted translation:

MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYISRTHLG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000305534 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000305526 Znf_LIM (56/58 aa) CDS CDS
ENSMUSE00000972847 Znf_LIM (3/58 aa) | Znf_LIM (55/55 aa) CDS Deleted
ENSMUSE00001047421 Homeodomain (56/56 aa) CDS CDS + stop codon + UTR
ENSMUSE00001073961 CDS
ENSMUSE00000468266 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000176044 protein_coding No protein product (NMD) view

Predicted translation:

MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYISRTHLG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000951252 CDS CDS
ENSMUSE00000305526 Znf_LIM (56/58 aa) CDS CDS
ENSMUSE00000972847 Znf_LIM (3/58 aa) | Znf_LIM (55/55 aa) CDS Deleted
ENSMUSE00001047421 Homeodomain (56/56 aa) CDS CDS + stop codon + UTR
ENSMUSE00000956335 CDS
ENSMUSE00000948423 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000176812 protein_coding No analysis available: incomplete transcript
ENSMUST00000177469 retained_intron Target region does not overlap transcript
ENSMUST00000176444 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0761_4_C08 PG00198_Z_3_F08 Isl1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0761_4_G06 PG00198_Z_3_F08 Isl1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0761_4_G08 PG00198_Z_3_F08 Isl1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00198_Z_3_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00198_Z_2_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00198_A_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00198_Z_7_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00198_Z_6_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00198_Z_5_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00198_Z_1_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 88605 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00198_Z_4_F08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
88605 Knockout First, Reporter-tagged insertion with conditional potential PCTS00198_A_F08