IKMC Project Report - KOMP-CSD (ID: 77476)
Isl1 MGI:101791 ENSMUSG00000042258 OTTMUSG00000039739
Mice no data available
Mutagenesis Predictions
This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000036060 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||
|
Predicted translation: MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYISRTHLG*
|
||||||||||||||||||||||||||||||||||||||
| ENSMUST00000176044 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||
|
Predicted translation: MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYISRTHLG*
|
||||||||||||||||||||||||||||||||||||||
| ENSMUST00000176812 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||
| ENSMUST00000177469 | retained_intron | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||
| ENSMUST00000176444 | retained_intron | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0761_4_C08 | PG00198_Z_3_F08 | Isl1tm2a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0761_4_G06 | PG00198_Z_3_F08 | Isl1tm2a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0761_4_G08 | PG00198_Z_3_F08 | Isl1tm2a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00198_Z_3_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00198_Z_2_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00198_A_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00198_Z_7_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00198_Z_6_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00198_Z_5_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00198_Z_1_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 88605 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00198_Z_4_F08 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 88605 | Knockout First, Reporter-tagged insertion with conditional potential | PCTS00198_A_F08 |