IKMC Project Report - KOMP-CSD (ID: 77648)

2010111I01Rik MGI:1919311 ENSMUSG00000021458 OTTMUSG00000030849
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000091560 protein_coding No protein product (NMD) view

Predicted translation:

MDIKLDPSRDDLPLMANTSHMLVKHYILDLDVDFGNQVIEGNIVLFFGDGNRFKNQSRSTQETFQMESEEADIFRTAEPC
HVPEMDSSTFSPKMGHRECAVCGKGDQDAFDNDGNHDNQERDSEISSSKYCCDTGNHGKRDFLLVLDCCDLSVLKVEEVD
VAAVPGLEKFTKAPKLLATPEKLRCEIVRDLVALPADAWREQLDCYTRCSQAPGCGELLIDSDNWSLRIRKTGTSTPADF
PRAIRIWYKTKPEGQSVAWTTDQNGRIHELALLCDHANAGLYLCNCSGVLDRNEAQGIPTR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000681617 Peptidase_M1_N (9/93 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000323804 Peptidase_M1_N (57/93 aa) CDS Deleted
ENSMUSE00000323793 Peptidase_M1_N (29/93 aa) CDS CDS + stop codon + UTR
ENSMUSE00000614335 Peptidase_M1_N (69/132 aa) CDS
ENSMUSE00000614334 Peptidase_M1_N (64/132 aa) CDS
ENSMUSE00000614333 CDS
ENSMUSE00000614332 CDS
ENSMUSE00000614331 CDS
ENSMUSE00000614330 CDS
ENSMUSE00000614329 CDS
ENSMUSE00000614328 Peptidase_M1_C (7/146 aa) CDS
ENSMUSE00000410517 Peptidase_M1_C (25/146 aa) CDS
ENSMUSE00001021567 Peptidase_M1_C (39/146 aa) CDS
ENSMUSE00001089960 Peptidase_M1_C (29/146 aa) CDS
ENSMUSE00000681602 Peptidase_M1_C (46/146 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000021911 protein_coding No protein product (NMD) view

Predicted translation:

MDIKLDPSRDDLPLMANTSHMLVKHYILDLDVDFGNQVIEGNIVLFFGDGNRFKNQSRSTQETFQMESEEADIFRTAEPC
HVPEMDSSTFSPKMGHRECAVCGKGDQDAFDNDGNHDNQERDSEISSSKYCCDTGNHGKRDFLLVLDCCDLSVLKVEEVD
VAAVPGLEKFTKAPKLLATPEKLRCEIVRDLVALPADAWREQLDCYTRCSQAPGCGELLIDSDNWSLRIRKTGTSTPADF
PRAIRIWYKTKPEGQSVAWTTDQNGSELALLCDHANAGLYLCNCSGVLDRNEAQGIPTR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000323812 Peptidase_M1_N (9/91 aa) CDS CDS
ENSMUSE00000323804 Peptidase_M1_N (57/91 aa) CDS Deleted
ENSMUSE00000894414 Peptidase_M1_N (27/91 aa) CDS CDS + stop codon + UTR
ENSMUSE00000884960 Peptidase_M1_N (69/132 aa) CDS
ENSMUSE00000614334 Peptidase_M1_N (64/132 aa) CDS
ENSMUSE00000614333 CDS
ENSMUSE00000614332 CDS
ENSMUSE00000614331 CDS
ENSMUSE00000614330 CDS
ENSMUSE00000614329 CDS
ENSMUSE00000614328 Peptidase_M1_C (7/146 aa) CDS
ENSMUSE00000410517 Peptidase_M1_C (25/146 aa) CDS
ENSMUSE00001021567 Peptidase_M1_C (39/146 aa) CDS
ENSMUSE00001089960 Peptidase_M1_C (29/146 aa) CDS
ENSMUSE00000641517 Peptidase_M1_C (46/146 aa) CDS + stop codon + UTR
ENSMUSE00000570645 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000159152 protein_coding Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 210522 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_7_E05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 210522 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00200_Z_4_E05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 210522 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00200_A_E05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
210522 Knockout First, Reporter-tagged insertion with conditional potential PCTS00200_A_E05