IKMC Project Report - EUCOMM (ID: 78745)

Ptgs2 MGI:97798 ENSMUSG00000032487
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000035065 protein_coding No protein product (NMD) view

Predicted translation:

MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTH
FKGVWNIVNNIPFLRSLIMKYVLTCGLKSHLW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000404244 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000220073 CDS CDS
ENSMUSE00000220071 CDS CDS
ENSMUSE00000220067 Haem_peroxidase_animal (22/72 aa) CDS Deleted
ENSMUSE00000220068 Haem_peroxidase_animal (51/72 aa) | Haem_peroxidase_animal (3/350 aa) CDS Deleted
ENSMUSE00000220069 Haem_peroxidase_animal (28/350 aa) CDS CDS + stop codon + UTR
ENSMUSE00000262815 Haem_peroxidase_animal (83/350 aa) CDS
ENSMUSE00000262810 Haem_peroxidase_animal (96/350 aa) CDS
ENSMUSE00000262802 Haem_peroxidase_animal (50/350 aa) CDS
ENSMUSE00000372610 Haem_peroxidase_animal (92/350 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available