IKMC Project Report - EUCOMM (ID: 78829)

Man2b1 MGI:107286 ENSMUSG00000005142
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000034121 protein_coding No protein product (NMD) view

Predicted translation:

MGTGPLTSGVRAGGGNTGWLWMSSCNLGSPVLPISFLFWLLLAAPGARAAGYKTCPPTKPGMLNVHLLPHTHDDVGWLKT
VDQYYYGILSDVQHASVQYILDSVVSSLLEKPTRRFIYVEMAFFSRWWKQQTSATQDAVRNLVRQDGF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000468678 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000502023 Glyco_hydro_38_core (24/318 aa) CDS CDS
ENSMUSE00000499526 Glyco_hydro_38_core (59/318 aa) CDS CDS
ENSMUSE00000480932 Glyco_hydro_38_core (65/318 aa) CDS Deleted
ENSMUSE00000480070 Glyco_hydro_38_core (45/318 aa) CDS CDS + stop codon + UTR
ENSMUSE00000477559 Glyco_hydro_38_core (49/318 aa) CDS
ENSMUSE00000476932 Glyco_hydro_38_core (39/318 aa) CDS
ENSMUSE00000489561 Glyco_hydro_38_core (28/318 aa) CDS
ENSMUSE00000487952 Glyco_hydro_38_core (13/318 aa) | Glyco_hydro_38_cen_dom (23/79 aa) CDS
ENSMUSE00000487037 Glyco_hydro_38_cen_dom (27/79 aa) CDS
ENSMUSE00000498471 Glyco_hydro_38_cen_dom (30/79 aa) CDS
ENSMUSE00000490892 CDS
ENSMUSE00000497396 Glyco_hydro_38_C (38/493 aa) CDS
ENSMUSE00000492768 Glyco_hydro_38_C (63/493 aa) CDS
ENSMUSE00000502139 Glyco_hydro_38_C (33/493 aa) CDS
ENSMUSE00000501097 Glyco_hydro_38_C (40/493 aa) CDS
ENSMUSE00000499322 Glyco_hydro_38_C (40/493 aa) CDS
ENSMUSE00000511956 Glyco_hydro_38_C (35/493 aa) CDS
ENSMUSE00000471717 Glyco_hydro_38_C (30/493 aa) CDS
ENSMUSE00000507375 Glyco_hydro_38_C (27/493 aa) CDS
ENSMUSE00000506300 Glyco_hydro_38_C (76/493 aa) CDS
ENSMUSE00000519052 Glyco_hydro_38_C (52/493 aa) CDS
ENSMUSE00000509118 Glyco_hydro_38_C (35/493 aa) CDS
ENSMUSE00000508610 Glyco_hydro_38_C (28/493 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 243314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00204_Z_4_A12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
243314 Knockout First, Reporter-tagged insertion with conditional potential PCS00204_A_C11