IKMC Project Report - EUCOMM (ID: 79055)
Ing5 MGI:1922816 ENSMUSG00000026283
Mice no data available
Mutagenesis Predictions
This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000027505 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEGLSLLTVSYLCTPLMCWTCLWIRMSLHTACATRCPTGR*
|
||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones no data available
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 209640 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04006_Z_5_H04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 209640 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04006_Z_1_H04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 209640 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04006_Z_1_D03 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 209640 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04006_Z_1_F09 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 209640 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04006_Z_1_H07 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 209640 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR04006_Z_1_G05 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 209640 | Knockout First, Reporter-tagged insertion with conditional potential | PCS04006_A_A10 |