IKMC Project Report - EUCOMM (ID: 79055)

Ing5 MGI:1922816 ENSMUSG00000026283
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027505 protein_coding No protein product (NMD) view

Predicted translation: 

MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEGLSLLTVSYLCTPLMCWTCLWIRMSLHTACATRCPTGR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000282269 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000541260 CDS CDS
ENSMUSE00000282247 CDS Deleted
ENSMUSE00000157531 CDS Deleted
ENSMUSE00000157533 CDS Deleted
ENSMUSE00000157534 Znf_PHD-finger (18/47 aa) CDS CDS + stop codon + UTR
ENSMUSE00000157532 Znf_PHD-finger (21/47 aa) CDS
ENSMUSE00000157530 Znf_PHD-finger (9/47 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 209640 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04006_Z_5_H04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 209640 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04006_Z_1_H04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 209640 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04006_Z_1_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 209640 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04006_Z_1_F09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 209640 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04006_Z_1_H07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 209640 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04006_Z_1_G05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
209640 Knockout First, Reporter-tagged insertion with conditional potential PCS04006_A_A10