IKMC Project Report - KOMP-CSD (ID: 79127)

Ano3 MGI:3613666 ENSMUSG00000074968 OTTMUSG00000015134
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000099623 protein_coding No protein product (NMD) view

Predicted translation: 

MVHHSGSIQSFKQQKGMNISKSEITTEASLKPSRRSLPCLAQSYAHSKSLSQSASLFQSTESESQAPTSVTFLSADKPEH
VTSEESRKDSTLKCSFADLSDFCLALGKDKDYLDESEHANYDRSRLLNDFVTKDKPASKTKLSKNDMSYIASSGLLFKDG
KKRIDYILVYRKTNIQYDKRNTFEKNLRAEGLMLEKEEEMLLY*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000794482 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000686405 CDS CDS
ENSMUSE00000686403 CDS CDS
ENSMUSE00000686402 CDS CDS
ENSMUSE00000686401 CDS CDS
ENSMUSE00000642678 CDS Deleted
ENSMUSE00000686396 CDS CDS + stop codon + UTR
ENSMUSE00000686394 CDS
ENSMUSE00000642675 CDS
ENSMUSE00000642674 CDS
ENSMUSE00000642673 Anoctamin (1/568 aa) CDS
ENSMUSE00000642672 Anoctamin (46/568 aa) CDS
ENSMUSE00000642671 Anoctamin (33/568 aa) CDS
ENSMUSE00000642670 Anoctamin (21/568 aa) CDS
ENSMUSE00000686389 Anoctamin (28/568 aa) CDS
ENSMUSE00000686387 Anoctamin (47/568 aa) CDS
ENSMUSE00000686385 Anoctamin (55/568 aa) CDS
ENSMUSE00000686384 Anoctamin (13/568 aa) CDS
ENSMUSE00000686382 Anoctamin (38/568 aa) CDS
ENSMUSE00000686381 Anoctamin (20/568 aa) CDS
ENSMUSE00000686380 Anoctamin (33/568 aa) CDS
ENSMUSE00000686379 Anoctamin (46/568 aa) CDS
ENSMUSE00000686378 Anoctamin (52/568 aa) CDS
ENSMUSE00000686377 Anoctamin (50/568 aa) CDS
ENSMUSE00000686376 Anoctamin (28/568 aa) CDS
ENSMUSE00000686375 Anoctamin (36/568 aa) CDS
ENSMUSE00000642681 Anoctamin (31/568 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000111019 protein_coding No protein product (NMD) view

Predicted translation: 

MVHHSGSIQSFKQQKGMNISKSEITTEASLKPSRRSLPCLAQSYAHSKSLSQSASLFQSTESESQAPTSVTFLSADKPEH
VTSEESRKDSTLKCSFADLSDFCLALGKDKDYLDESEHANYDRSRLLNDFVTKDKPASKTKLSKNDMSYIASSGLLFKDG
KKRIDYILVYRKTNIQYDKRNTFEKNLRAEGLMLEKEEEMLLY*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000686374 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000686405 CDS CDS
ENSMUSE00000686403 CDS CDS
ENSMUSE00000686402 CDS CDS
ENSMUSE00000686401 CDS CDS
ENSMUSE00000642678 CDS Deleted
ENSMUSE00000686396 CDS CDS + stop codon + UTR
ENSMUSE00000686394 CDS
ENSMUSE00000642675 CDS
ENSMUSE00000642674 CDS
ENSMUSE00000642673 Anoctamin (1/241 aa) CDS
ENSMUSE00000642672 Anoctamin (46/241 aa) CDS
ENSMUSE00000642671 Anoctamin (33/241 aa) CDS
ENSMUSE00000642670 Anoctamin (21/241 aa) CDS
ENSMUSE00000686389 Anoctamin (28/241 aa) CDS
ENSMUSE00000686387 Anoctamin (47/241 aa) CDS
ENSMUSE00000686385 Anoctamin (55/241 aa) CDS
ENSMUSE00000686373 Anoctamin (13/241 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000140777 protein_coding Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0823_2_G04 HTGRS06019_A_A08 Ano3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0823_2_C04 HTGRS06019_A_A08 Ano3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.6 - 0.51 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0823_2_F04 HTGRS06019_A_A08 Ano3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.8 - 0.71 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06019_A_1_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06019_A_3_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS06019_A_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06019_A_5_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06019_A_4_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06019_A_7_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06019_A_8_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 114225 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06019_A_2_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
114225 Knockout-First - Reporter Tagged Insertion PCS06019_A_A08