IKMC Project Report - KOMP-CSD (ID: 79138)

1700013H16Rik MGI:1922764 ENSMUSG00000054727 OTTMUSG00000017387
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000067940 protein_coding No protein product (NMD) view

Predicted translation: 

MFPRGRRDPEEFKSTPEDPEEPESTTRDPGGLESTPGDPEGFESTPGDPEGFESTPGDPKGFESTPGDPEGFESTPGDPV
GFESTPTEEEHLAVYSFDDDFQHPRVLQRSEELRSTSDSCRERSPVELFTDPG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000452592 UTR UTR
ENSMUSE00000452589 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000452584 CDS CDS
ENSMUSE00000452581 CDS Deleted
ENSMUSE00000452578 Cor1/Xlr/Xmr (36/130 aa) CDS CDS + stop codon + UTR
ENSMUSE00000452576 Cor1/Xlr/Xmr (34/130 aa) CDS
ENSMUSE00000452572 Cor1/Xlr/Xmr (33/130 aa) CDS
ENSMUSE00000452586 Cor1/Xlr/Xmr (28/130 aa) CDS
ENSMUSE00000452566 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0864_5_E10 HTGRS6006_B_C02 1700013H16Riktm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0864_5_C11 HTGRS6006_B_C02 1700013H16Riktm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0864_5_D11 HTGRS6006_B_C02 1700013H16Riktm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0864_5_E11 HTGRS6006_B_C02 1700013H16Riktm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0864_5_C10 HTGRS6006_B_C02 1700013H16Riktm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS6006_B_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_6_C03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_3_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_1_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_4_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_2_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_8_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_5_C03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00078_B_C07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_5_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_7_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 55723 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06006_B_6_C02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
55723 Knockout First, Reporter-tagged insertion with conditional potential PCS6006_B_C02
55723 Knockout First, Reporter-tagged insertion with conditional potential PCS00078_A_C07