IKMC Project Report - KOMP-CSD (ID: 79259)

Capn6 MGI:1100850 ENSMUSG00000067276 OTTMUSG00000018841
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000087316 protein_coding No protein product (NMD) view

Predicted translation: 

MGPPLKLFKNQKYQELKQECMKDGRLFCDPTFLPENDSLFFNRLLPGKVVWKRPQDISDDPHLIVGNISNHQLIQGRLGN
KAMISAFSCLAVQESHWTKAAGLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000653293 UTR UTR
ENSMUSE00000544957 Peptidase_C2_calpain_cat (29/316 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000544955 Peptidase_C2_calpain_cat (44/316 aa) CDS CDS
ENSMUSE00000544954 Peptidase_C2_calpain_cat (70/316 aa) CDS Deleted
ENSMUSE00000544953 Peptidase_C2_calpain_cat (65/316 aa) CDS CDS + stop codon + UTR
ENSMUSE00000544952 Peptidase_C2_calpain_cat (65/316 aa) CDS
ENSMUSE00000544951 Peptidase_C2_calpain_cat (27/316 aa) CDS
ENSMUSE00000544950 Peptidase_C2_calpain_cat (19/316 aa) | Calpain_domain_III (30/139 aa) CDS
ENSMUSE00000544948 Calpain_domain_III (41/139 aa) CDS
ENSMUSE00000544945 Calpain_domain_III (68/139 aa) CDS
ENSMUSE00000544944 Calpain_domain_III (1/139 aa) | C2_Ca-dep (17/79 aa) CDS
ENSMUSE00000544941 C2_Ca-dep (46/79 aa) CDS
ENSMUSE00000544940 C2_Ca-dep (17/79 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000151154 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_3_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS6006_B_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_5_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_8_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_2_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_6_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_4_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_7_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82411 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06006_B_1_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
82411 Knockout-First - Reporter Tagged Insertion PCS6006_B_F12